Anti PDZD8 pAb (ATL-HPA051610)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051610-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PDZD8
Alternative Gene Name: bA129M16.2, FLJ34427, PDZK8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074746: 95%, ENSRNOG00000009460: 96%
Entrez Gene ID: 118987
Uniprot ID: Q8NEN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDR |
Gene Sequence | DEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDREANVHCTLELSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDR |
Gene ID - Mouse | ENSMUSG00000074746 |
Gene ID - Rat | ENSRNOG00000009460 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDZD8 pAb (ATL-HPA051610) | |
Datasheet | Anti PDZD8 pAb (ATL-HPA051610) Datasheet (External Link) |
Vendor Page | Anti PDZD8 pAb (ATL-HPA051610) at Atlas Antibodies |
Documents & Links for Anti PDZD8 pAb (ATL-HPA051610) | |
Datasheet | Anti PDZD8 pAb (ATL-HPA051610) Datasheet (External Link) |
Vendor Page | Anti PDZD8 pAb (ATL-HPA051610) |