Anti PDZD8 pAb (ATL-HPA015716)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015716-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PDZD8
Alternative Gene Name: bA129M16.2, FLJ34427, PDZK8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074746: 89%, ENSRNOG00000009460: 85%
Entrez Gene ID: 118987
Uniprot ID: Q8NEN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SCLFDIEACHRYLNIALWCRDPFKLGGLICLGHVSLKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTRTALRNLSMQKGFNDKFCYGDITIHFKYLKEGESDHHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENKHSFQDTQF |
| Gene Sequence | SCLFDIEACHRYLNIALWCRDPFKLGGLICLGHVSLKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTRTALRNLSMQKGFNDKFCYGDITIHFKYLKEGESDHHVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTENKHSFQDTQF |
| Gene ID - Mouse | ENSMUSG00000074746 |
| Gene ID - Rat | ENSRNOG00000009460 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDZD8 pAb (ATL-HPA015716) | |
| Datasheet | Anti PDZD8 pAb (ATL-HPA015716) Datasheet (External Link) |
| Vendor Page | Anti PDZD8 pAb (ATL-HPA015716) at Atlas Antibodies |
| Documents & Links for Anti PDZD8 pAb (ATL-HPA015716) | |
| Datasheet | Anti PDZD8 pAb (ATL-HPA015716) Datasheet (External Link) |
| Vendor Page | Anti PDZD8 pAb (ATL-HPA015716) |
| Citations for Anti PDZD8 pAb (ATL-HPA015716) – 2 Found |
| Walch, Philipp; Selkrig, Joel; Knodler, Leigh A; Rettel, Mandy; Stein, Frank; Fernandez, Keith; Viéitez, Cristina; Potel, Clément M; Scholzen, Karoline; Geyer, Matthias; Rottner, Klemens; Steele-Mortimer, Olivia; Savitski, Mikhail M; Holden, David W; Typas, Athanasios. Global mapping of Salmonella enterica-host protein-protein interactions during infection. Cell Host & Microbe. 2021;29(8):1316-1332.e12. PubMed |
| Morita, Keiko; Wada, Mariko; Nakatani, Kohta; Matsumoto, Yuki; Hayashi, Nahoki; Yamahata, Ikuko; Mitsunari, Kotone; Mukae, Nagi; Takahashi, Masatomo; Izumi, Yoshihiro; Bamba, Takeshi; Shirane, Michiko. PDZD8-deficient mice accumulate cholesteryl esters in the brain as a result of impaired lipophagy. Iscience. 2022;25(12):105612. PubMed |