Anti PDZD2 pAb (ATL-HPA076072)
Atlas Antibodies
- SKU:
- ATL-HPA076072-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PDZD2
Alternative Gene Name: KIAA0300, PDZK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022197: 44%, ENSRNOG00000013140: 42%
Entrez Gene ID: 23037
Uniprot ID: O15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETSINAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKP |
Gene Sequence | SKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETSINAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKP |
Gene ID - Mouse | ENSMUSG00000022197 |
Gene ID - Rat | ENSRNOG00000013140 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDZD2 pAb (ATL-HPA076072) | |
Datasheet | Anti PDZD2 pAb (ATL-HPA076072) Datasheet (External Link) |
Vendor Page | Anti PDZD2 pAb (ATL-HPA076072) at Atlas Antibodies |
Documents & Links for Anti PDZD2 pAb (ATL-HPA076072) | |
Datasheet | Anti PDZD2 pAb (ATL-HPA076072) Datasheet (External Link) |
Vendor Page | Anti PDZD2 pAb (ATL-HPA076072) |