Anti PDXK pAb (ATL-HPA030196 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030196-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: pyridoxal (pyridoxine, vitamin B6) kinase
Gene Name: PDXK
Alternative Gene Name: C21orf124, C21orf97, FLJ21324, FLJ31940, MGC15873, PKH, PNK, PRED79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032788: 88%, ENSRNOG00000049937: 86%
Entrez Gene ID: 8566
Uniprot ID: O00764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQ
Gene Sequence LLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQ
Gene ID - Mouse ENSMUSG00000032788
Gene ID - Rat ENSRNOG00000049937
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDXK pAb (ATL-HPA030196 w/enhanced validation)
Datasheet Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PDXK pAb (ATL-HPA030196 w/enhanced validation)
Datasheet Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDXK pAb (ATL-HPA030196 w/enhanced validation)
Citations for Anti PDXK pAb (ATL-HPA030196 w/enhanced validation) – 1 Found
Chen, Chi-Chao; Li, Bo; Millman, Scott E; Chen, Cynthia; Li, Xiang; Morris, John P 4th; Mayle, Allison; Ho, Yu-Jui; Loizou, Evangelia; Liu, Hui; Qin, Weige; Shah, Hardik; Violante, Sara; Cross, Justin R; Lowe, Scott W; Zhang, Lingbo. Vitamin B6 Addiction in Acute Myeloid Leukemia. Cancer Cell. 2020;37(1):71-84.e7.  PubMed