Anti PDIA3 pAb (ATL-HPA003230 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003230-25

Protein Description: protein disulfide isomerase family A, member 3
Gene Name: PDIA3
Alternative Gene Name: ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027248: 91%, ENSRNOG00000015018: 91%
Entrez Gene ID: 2923
Uniprot ID: P30101
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
• Gene Sequence: PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
• Gene ID - Mouse: ENSMUSG00000027248
• Gene ID - Rat: ENSRNOG00000015018
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDIA3 pAb (ATL-HPA003230 w/enhanced validation) – 7 Found

Podyma-Inoue, Katarzyna A; Moriwaki, Takuya; Rajapakshe, Anupama R; Terasawa, Kazue; Hara-Yokoyama, Miki. Characterization of Heparan Sulfate Proteoglycan-positive Recycling Endosomes Isolated from Glioma Cells. Cancer Genomics & Proteomics. 2016;13(6):443-452. 

Racapé, Maud; Duong Van Huyen, Jean-Paul; Danger, Richard; Giral, Magali; Bleicher, Françoise; Foucher, Yohann; Pallier, Annaïck; Pilet, Paul; Tafelmeyer, Petra; Ashton-Chess, Joanna; Dugast, Emilie; Pettré, Ségolène; Charreau, Béatrice; Soulillou, Jean-Paul; Brouard, Sophie. The involvement of SMILE/TMTC3 in endoplasmic reticulum stress response. Plos One. 6(5):e19321. 

Logan, Clare V; Szabadkai, György; Sharpe, Jenny A; Parry, David A; Torelli, Silvia; Childs, Anne-Marie; Kriek, Marjolein; Phadke, Rahul; Johnson, Colin A; Roberts, Nicola Y; Bonthron, David T; Pysden, Karen A; Whyte, Tamieka; Munteanu, Iulia; Foley, A Reghan; Wheway, Gabrielle; Szymanska, Katarzyna; Natarajan, Subaashini; Abdelhamed, Zakia A; Morgan, Joanne E; Roper, Helen; Santen, Gijs W E; Niks, Erik H; van der Pol, W Ludo; Lindhout, Dick; Raffaello, Anna; De Stefani, Diego; den Dunnen, Johan T; Sun, Yu; Ginjaar, Ieke; Sewry, Caroline A; Hurles, Matthew; Rizzuto, Rosario; Duchen, Michael R; Muntoni, Francesco; Sheridan, Eamonn. Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling. Nature Genetics. 2014;46(2):188-93. 

Feng, Huixing; Li, Xi; Chan, Vincent; Chen, Wei Ning. Proteomics based identification of cell migration related proteins in HBV expressing HepG2 cells. Plos One. 9(4):e95621. 

Bechor, Edna; Dahan, Iris; Fradin, Tanya; Berdichevsky, Yevgeny; Zahavi, Anat; Federman Gross, Aya; Rafalowski, Meirav; Pick, Edgar. The dehydrogenase region of the NADPH oxidase component Nox2 acts as a protein disulfide isomerase (PDI) resembling PDIA3 with a role in the binding of the activator protein p67 (phox.). Frontiers In Chemistry. 3( 25699251):3. 

Matos, Ana M; Pinto, Francisco R; Barros, Patrícia; Amaral, Margarida D; Pepperkok, Rainer; Matos, Paulo. Inhibition of calpain 1 restores plasma membrane stability to pharmacologically rescued Phe508del-CFTR variant. The Journal Of Biological Chemistry. 2019;294(36):13396-13410. 

Möller-Kerutt, Annika; Schönhoff, Birgit; Rellmann, Yvonne; George, Britta; Braun, Daniela Anne; Pavenstädt, Hermann; Weide, Thomas. Loss of surface transport is a main cellular pathomechanism of CRB2 variants causing podocytopathies. Life Science Alliance. 2023;6(3)