Anti PDGFRB pAb (ATL-HPA028499)

Atlas Antibodies

Catalog No.: ATL-HPA028499-25

Protein Description: platelet-derived growth factor receptor, beta polypeptide
Gene Name: PDGFRB
Alternative Gene Name: CD140b, JTK12, PDGFR, PDGFR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024620: 76%, ENSRNOG00000018461: 76%
Entrez Gene ID: 5159
Uniprot ID: P09619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL
• Gene Sequence: AQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVAL
• Gene ID - Mouse: ENSMUSG00000024620
• Gene ID - Rat: ENSRNOG00000018461
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDGFRB pAb (ATL-HPA028499) – 4 Found

Rorsman, Charlotte; Tsioumpekou, Maria; Heldin, Carl-Henrik; Lennartsson, Johan. The Ubiquitin Ligases c-Cbl and Cbl-b Negatively Regulate Platelet-derived Growth Factor (PDGF) BB-induced Chemotaxis by Affecting PDGF Receptor β (PDGFRβ) Internalization and Signaling. The Journal Of Biological Chemistry. 2016;291(22):11608-18. 

Higuchi, Akio; Oshima, Takashi; Yoshihara, Kazue; Sakamaki, Kentaro; Aoyama, Toru; Suganuma, Nobuyasu; Yamamoto, Naoto; Sato, Tsutomu; Cho, Haruhiko; Shiozawa, Manabu; Yoshikawa, Takaki; Rino, Yasushi; Kunisaki, Chikara; Imada, Toshio; Masuda, Munetaka. Clinical significance of platelet-derived growth factor receptor-β gene expression in stage II/III gastric cancer with S-1 adjuvant chemotherapy. Oncology Letters. 2017;13(2):905-911. 

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Steller, Ernst J A; Raats, Danielle A; Koster, Jan; Rutten, Bert; Govaert, Klaas M; Emmink, Benjamin L; Snoeren, Nikol; van Hooff, Sander R; Holstege, Frank C P; Maas, Coen; Borel Rinkes, Inne H M; Kranenburg, Onno. PDGFRB promotes liver metastasis formation of mesenchymal-like colorectal tumor cells. Neoplasia (New York, N.y.). 2013;15(2):204-17.