Anti PDE6H pAb (ATL-HPA045118)

Atlas Antibodies

Catalog No.:
ATL-HPA045118-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 6H
Gene Name: PDE6H
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064330: 100%, ENSRNOG00000005947: 100%
Entrez Gene ID: 5149
Uniprot ID: Q13956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELA
Gene Sequence PRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELA
Gene ID - Mouse ENSMUSG00000064330
Gene ID - Rat ENSRNOG00000005947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE6H pAb (ATL-HPA045118)
Datasheet Anti PDE6H pAb (ATL-HPA045118) Datasheet (External Link)
Vendor Page Anti PDE6H pAb (ATL-HPA045118) at Atlas Antibodies

Documents & Links for Anti PDE6H pAb (ATL-HPA045118)
Datasheet Anti PDE6H pAb (ATL-HPA045118) Datasheet (External Link)
Vendor Page Anti PDE6H pAb (ATL-HPA045118)