Anti PDE6D pAb (ATL-HPA037434)

Atlas Antibodies

Catalog No.: ATL-HPA037434-25

Protein Description: phosphodiesterase 6D, cGMP-specific, rod, delta
Gene Name: PDE6D
Alternative Gene Name: JBTS22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026239: 99%, ENSRNOG00000018610: 97%
Entrez Gene ID: 5147
Uniprot ID: O43924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRL
• Gene Sequence: KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRL
• Gene ID - Mouse: ENSMUSG00000026239
• Gene ID - Rat: ENSRNOG00000018610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDE6D pAb (ATL-HPA037434) – 1 Found

Thomas, Sophie; Wright, Kevin J; Le Corre, Stéphanie; Micalizzi, Alessia; Romani, Marta; Abhyankar, Avinash; Saada, Julien; Perrault, Isabelle; Amiel, Jeanne; Litzler, Julie; Filhol, Emilie; Elkhartoufi, Nadia; Kwong, Mandy; Casanova, Jean-Laurent; Boddaert, Nathalie; Baehr, Wolfgang; Lyonnet, Stanislas; Munnich, Arnold; Burglen, Lydie; Chassaing, Nicolas; Encha-Ravazi, Ferechté; Vekemans, Michel; Gleeson, Joseph G; Valente, Enza Maria; Jackson, Peter K; Drummond, Iain A; Saunier, Sophie; Attié-Bitach, Tania. A homozygous PDE6D mutation in Joubert syndrome impairs targeting of farnesylated INPP5E protein to the primary cilium. Human Mutation. 2014;35(1):137-46.