Anti PDE5A pAb (ATL-HPA004729)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004729-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PDE5A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053965: 92%, ENSRNOG00000014443: 91%
Entrez Gene ID: 8654
Uniprot ID: O76074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGN |
| Gene Sequence | FAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGN |
| Gene ID - Mouse | ENSMUSG00000053965 |
| Gene ID - Rat | ENSRNOG00000014443 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDE5A pAb (ATL-HPA004729) | |
| Datasheet | Anti PDE5A pAb (ATL-HPA004729) Datasheet (External Link) |
| Vendor Page | Anti PDE5A pAb (ATL-HPA004729) at Atlas Antibodies |
| Documents & Links for Anti PDE5A pAb (ATL-HPA004729) | |
| Datasheet | Anti PDE5A pAb (ATL-HPA004729) Datasheet (External Link) |
| Vendor Page | Anti PDE5A pAb (ATL-HPA004729) |
| Citations for Anti PDE5A pAb (ATL-HPA004729) – 2 Found |
| Teich, Andrew F; Sakurai, Mikako; Patel, Mitesh; Holman, Cameron; Saeed, Faisal; Fiorito, Jole; Arancio, Ottavio. PDE5 Exists in Human Neurons and is a Viable Therapeutic Target for Neurologic Disease. Journal Of Alzheimer's Disease : Jad. 52(1):295-302. PubMed |
| Chau, Yasmin; Li, Fu-Shuang; Levsh, Olesya; Weng, Jing-Ke. Exploration of icariin analog structure space reveals key features driving potent inhibition of human phosphodiesterase-5. Plos One. 14(9):e0222803. PubMed |