Anti PDE5A pAb (ATL-HPA004729)

Atlas Antibodies

Catalog No.:
ATL-HPA004729-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 5A, cGMP-specific
Gene Name: PDE5A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053965: 92%, ENSRNOG00000014443: 91%
Entrez Gene ID: 8654
Uniprot ID: O76074
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGN
Gene Sequence FAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGN
Gene ID - Mouse ENSMUSG00000053965
Gene ID - Rat ENSRNOG00000014443
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE5A pAb (ATL-HPA004729)
Datasheet Anti PDE5A pAb (ATL-HPA004729) Datasheet (External Link)
Vendor Page Anti PDE5A pAb (ATL-HPA004729) at Atlas Antibodies

Documents & Links for Anti PDE5A pAb (ATL-HPA004729)
Datasheet Anti PDE5A pAb (ATL-HPA004729) Datasheet (External Link)
Vendor Page Anti PDE5A pAb (ATL-HPA004729)
Citations for Anti PDE5A pAb (ATL-HPA004729) – 2 Found
Teich, Andrew F; Sakurai, Mikako; Patel, Mitesh; Holman, Cameron; Saeed, Faisal; Fiorito, Jole; Arancio, Ottavio. PDE5 Exists in Human Neurons and is a Viable Therapeutic Target for Neurologic Disease. Journal Of Alzheimer's Disease : Jad. 52(1):295-302.  PubMed
Chau, Yasmin; Li, Fu-Shuang; Levsh, Olesya; Weng, Jing-Ke. Exploration of icariin analog structure space reveals key features driving potent inhibition of human phosphodiesterase-5. Plos One. 14(9):e0222803.  PubMed