Anti PDE4B pAb (ATL-HPA003005)

Atlas Antibodies

Catalog No.: ATL-HPA003005-25

Protein Description: phosphodiesterase 4B, cAMP-specific
Gene Name: PDE4B
Alternative Gene Name: DPDE4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028525: 98%, ENSRNOG00000005905: 98%
Entrez Gene ID: 5142
Uniprot ID: Q07343
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMT
• Gene Sequence: SGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMT
• Gene ID - Mouse: ENSMUSG00000028525
• Gene ID - Rat: ENSRNOG00000005905
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDE4B pAb (ATL-HPA003005) – 2 Found

He, Rong-Quan; Li, Xiao-Jiao; Liang, Lu; Xie, You; Luo, Dian-Zhong; Ma, Jie; Peng, Zhi-Gang; Hu, Xiao-Hua; Chen, Gang. The suppressive role of miR-542-5p in NSCLC: the evidence from clinical data and in vivo validation using a chick chorioallantoic membrane model. Bmc Cancer. 2017;17(1):655. 

Cedervall, Peder; Aulabaugh, Ann; Geoghegan, Kieran F; McLellan, Thomas J; Pandit, Jayvardhan. Engineered stabilization and structural analysis of the autoinhibited conformation of PDE4. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(12):E1414-22.