Anti PDE1B pAb (ATL-HPA018492)

Atlas Antibodies

Catalog No.:
ATL-HPA018492-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 1B, calmodulin-dependent
Gene Name: PDE1B
Alternative Gene Name: PDES1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022489: 92%, ENSRNOG00000036828: 93%
Entrez Gene ID: 5153
Uniprot ID: Q01064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGN
Gene Sequence TFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGN
Gene ID - Mouse ENSMUSG00000022489
Gene ID - Rat ENSRNOG00000036828
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE1B pAb (ATL-HPA018492)
Datasheet Anti PDE1B pAb (ATL-HPA018492) Datasheet (External Link)
Vendor Page Anti PDE1B pAb (ATL-HPA018492) at Atlas Antibodies

Documents & Links for Anti PDE1B pAb (ATL-HPA018492)
Datasheet Anti PDE1B pAb (ATL-HPA018492) Datasheet (External Link)
Vendor Page Anti PDE1B pAb (ATL-HPA018492)