Anti PDE11A pAb (ATL-HPA034560)

Atlas Antibodies

Catalog No.:
ATL-HPA034560-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 11A
Gene Name: PDE11A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075270: 99%, ENSRNOG00000024457: 99%
Entrez Gene ID: 50940
Uniprot ID: Q9HCR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
Gene Sequence VVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
Gene ID - Mouse ENSMUSG00000075270
Gene ID - Rat ENSRNOG00000024457
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE11A pAb (ATL-HPA034560)
Datasheet Anti PDE11A pAb (ATL-HPA034560) Datasheet (External Link)
Vendor Page Anti PDE11A pAb (ATL-HPA034560) at Atlas Antibodies

Documents & Links for Anti PDE11A pAb (ATL-HPA034560)
Datasheet Anti PDE11A pAb (ATL-HPA034560) Datasheet (External Link)
Vendor Page Anti PDE11A pAb (ATL-HPA034560)