Anti PDCD5 pAb (ATL-HPA018471 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018471-25

Protein Description: programmed cell death 5
Gene Name: PDCD5
Alternative Gene Name: MGC9294, TFAR19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030417: 97%, ENSRNOG00000050827: 97%
Entrez Gene ID: 9141
Uniprot ID: O14737
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV
• Gene Sequence: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV
• Gene ID - Mouse: ENSMUSG00000030417
• Gene ID - Rat: ENSRNOG00000050827
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.