Anti PCSK1N pAb (ATL-HPA003925 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003925-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: proprotein convertase subtilisin/kexin type 1 inhibitor
Gene Name: PCSK1N
Alternative Gene Name: SAAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039278: 89%, ENSRNOG00000046021: 89%
Entrez Gene ID: 27344
Uniprot ID: Q9UHG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVP
Gene Sequence AETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVP
Gene ID - Mouse ENSMUSG00000039278
Gene ID - Rat ENSRNOG00000046021
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCSK1N pAb (ATL-HPA003925 w/enhanced validation)
Datasheet Anti PCSK1N pAb (ATL-HPA003925 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCSK1N pAb (ATL-HPA003925 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PCSK1N pAb (ATL-HPA003925 w/enhanced validation)
Datasheet Anti PCSK1N pAb (ATL-HPA003925 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCSK1N pAb (ATL-HPA003925 w/enhanced validation)