Anti PCNA pAb (ATL-HPA030521 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030521-100
Shipping:
Calculated at Checkout
$520.00
Adding to cart… The item has been added
Protein Description: proliferating cell nuclear antigen
Gene Name: PCNA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027342: 98%, ENSRNOG00000021264: 98%
Entrez Gene ID: 5111
Uniprot ID: P12004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE
Gene Sequence SASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE
Gene ID - Mouse ENSMUSG00000027342
Gene ID - Rat ENSRNOG00000021264
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCNA pAb (ATL-HPA030521 w/enhanced validation)
Datasheet Anti PCNA pAb (ATL-HPA030521 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCNA pAb (ATL-HPA030521 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PCNA pAb (ATL-HPA030521 w/enhanced validation)
Datasheet Anti PCNA pAb (ATL-HPA030521 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PCNA pAb (ATL-HPA030521 w/enhanced validation)