Anti PCNA pAb (ATL-HPA030521 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030521-100

Protein Description: proliferating cell nuclear antigen
Gene Name: PCNA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027342: 98%, ENSRNOG00000021264: 98%
Entrez Gene ID: 5111
Uniprot ID: P12004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE
• Gene Sequence: SASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE
• Gene ID - Mouse: ENSMUSG00000027342
• Gene ID - Rat: ENSRNOG00000021264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.