Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023374-25

Protein Description: pericentriolar material 1
Gene Name: PCM1
Alternative Gene Name: PTC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031592: 94%, ENSRNOG00000010155: 95%
Entrez Gene ID: 5108
Uniprot ID: Q15154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE
• Gene Sequence: TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE
• Gene ID - Mouse: ENSMUSG00000031592
• Gene ID - Rat: ENSRNOG00000010155
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation) – 13 Found

See, Kelvin; Tan, Wilson L W; Lim, Eng How; Tiang, Zenia; Lee, Li Ting; Li, Peter Y Q; Luu, Tuan D A; Ackers-Johnson, Matthew; Foo, Roger S. Single cardiomyocyte nuclear transcriptomes reveal a lincRNA-regulated de-differentiation and cell cycle stress-response in vivo. Nature Communications. 2017;8(1):225. 

Clift, Dean; McEwan, William A; Labzin, Larisa I; Konieczny, Vera; Mogessie, Binyam; James, Leo C; Schuh, Melina. A Method for the Acute and Rapid Degradation of Endogenous Proteins. Cell. 2017;171(7):1692-1706.e18. 

Nothjunge, Stephan; Nührenberg, Thomas G; Grüning, Björn A; Doppler, Stefanie A; Preissl, Sebastian; Schwaderer, Martin; Rommel, Carolin; Krane, Markus; Hein, Lutz; Gilsbach, Ralf. DNA methylation signatures follow preformed chromatin compartments in cardiac myocytes. Nature Communications. 2017;8(1):1667. 

Zacchigna, Serena; Martinelli, Valentina; Moimas, Silvia; Colliva, Andrea; Anzini, Marco; Nordio, Andrea; Costa, Alessia; Rehman, Michael; Vodret, Simone; Pierro, Cristina; Colussi, Giulia; Zentilin, Lorena; Gutierrez, Maria Ines; Dirkx, Ellen; Long, Carlin; Sinagra, Gianfranco; Klatzmann, David; Giacca, Mauro. Paracrine effect of regulatory T cells promotes cardiomyocyte proliferation during pregnancy and after myocardial infarction. Nature Communications. 2018;9(1):2432. 

Vukusic, Kristina; Sandstedt, Mikael; Jonsson, Marianne; Jansson, Märta; Oldfors, Anders; Jeppsson, Anders; Dellgren, Göran; Lindahl, Anders; Sandstedt, Joakim. The Atrioventricular Junction: A Potential Niche Region for Progenitor Cells in the Adult Human Heart. Stem Cells And Development. 2019;28(16):1078-1088. 

Bergmann, Olaf; Zdunek, Sofia; Alkass, Kanar; Druid, Henrik; Bernard, Samuel; Frisén, Jonas. Identification of cardiomyocyte nuclei and assessment of ploidy for the analysis of cell turnover. Experimental Cell Research. 2011;317(2):188-94. 

Humbert, Melissa C; Weihbrecht, Katie; Searby, Charles C; Li, Yalan; Pope, Robert M; Sheffield, Val C; Seo, Seongjin. ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2012;109(48):19691-6. 

Zhang, Yan; Seo, Seongjin; Bhattarai, Sajag; Bugge, Kevin; Searby, Charles C; Zhang, Qihong; Drack, Arlene V; Stone, Edwin M; Sheffield, Val C. BBS mutations modify phenotypic expression of CEP290-related ciliopathies. Human Molecular Genetics. 2014;23(1):40-51. 

So, Chun; Seres, K Bianka; Steyer, Anna M; Mönnich, Eike; Clift, Dean; Pejkovska, Anastasija; Möbius, Wiebke; Schuh, Melina. A liquid-like spindle domain promotes acentrosomal spindle assembly in mammalian oocytes. Science (New York, N.y.). 2019;364(6447) 

Tan, Chia Yee; Wong, Jing Xuan; Chan, Pui Shi; Tan, Hansen; Liao, Dan; Chen, Weiming; Tan, Lek Wen; Ackers-Johnson, Matthew; Wakimoto, Hiroko; Seidman, Jonathan G; Seidman, Christine E; Lunde, Ida Gjervold; Zhu, Feng; Hu, Qidong; Bian, Jinsong; Wang, Jiong-Wei; Foo, Roger S; Jiang, Jianming. Yin Yang 1 Suppresses Dilated Cardiomyopathy and Cardiac Fibrosis Through Regulation of Bmp7 and Ctgf. Circulation Research. 2019;125(9):834-846. 

Hennig, Maria; Ewering, Lea; Pyschny, Simon; Shimoyama, Shinya; Olecka, Maja; Ewald, Dominik; Magarin, Manuela; Uebing, Anselm; Thierfelder, Ludwig; Jux, Christian; Drenckhahn, Jörg-Detlef. Dietary protein restriction throughout intrauterine and postnatal life results in potentially beneficial myocardial tissue remodeling in the adult mouse heart. Scientific Reports. 2019;9(1):15126. 

Cui, Miao; Olson, Eric N. Protocol for Single-Nucleus Transcriptomics of Diploid and Tetraploid Cardiomyocytes in Murine Hearts. Star Protocols. 2020;1(2):100049. 

Boikova, Aleksandra; Bywater, Megan J; Quaife-Ryan, Gregory A; Straube, Jasmin; Thompson, Lucy; Ascanelli, Camilla; Littlewood, Trevor D; Evan, Gerard I; Hudson, James E; Wilson, Catherine H. HRas and Myc synergistically induce cell cycle progression and apoptosis of murine cardiomyocytes. Frontiers In Cardiovascular Medicine. 9( 36337898):948281.