Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023374-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PCM1
Alternative Gene Name: PTC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031592: 94%, ENSRNOG00000010155: 95%
Entrez Gene ID: 5108
Uniprot ID: Q15154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE |
| Gene Sequence | TIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFE |
| Gene ID - Mouse | ENSMUSG00000031592 |
| Gene ID - Rat | ENSRNOG00000010155 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation) | |
| Datasheet | Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation) | |
| Datasheet | Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation) |
| Citations for Anti PCM1 pAb (ATL-HPA023374 w/enhanced validation) – 13 Found |
| See, Kelvin; Tan, Wilson L W; Lim, Eng How; Tiang, Zenia; Lee, Li Ting; Li, Peter Y Q; Luu, Tuan D A; Ackers-Johnson, Matthew; Foo, Roger S. Single cardiomyocyte nuclear transcriptomes reveal a lincRNA-regulated de-differentiation and cell cycle stress-response in vivo. Nature Communications. 2017;8(1):225. PubMed |
| Clift, Dean; McEwan, William A; Labzin, Larisa I; Konieczny, Vera; Mogessie, Binyam; James, Leo C; Schuh, Melina. A Method for the Acute and Rapid Degradation of Endogenous Proteins. Cell. 2017;171(7):1692-1706.e18. PubMed |
| Nothjunge, Stephan; Nührenberg, Thomas G; Grüning, Björn A; Doppler, Stefanie A; Preissl, Sebastian; Schwaderer, Martin; Rommel, Carolin; Krane, Markus; Hein, Lutz; Gilsbach, Ralf. DNA methylation signatures follow preformed chromatin compartments in cardiac myocytes. Nature Communications. 2017;8(1):1667. PubMed |
| Zacchigna, Serena; Martinelli, Valentina; Moimas, Silvia; Colliva, Andrea; Anzini, Marco; Nordio, Andrea; Costa, Alessia; Rehman, Michael; Vodret, Simone; Pierro, Cristina; Colussi, Giulia; Zentilin, Lorena; Gutierrez, Maria Ines; Dirkx, Ellen; Long, Carlin; Sinagra, Gianfranco; Klatzmann, David; Giacca, Mauro. Paracrine effect of regulatory T cells promotes cardiomyocyte proliferation during pregnancy and after myocardial infarction. Nature Communications. 2018;9(1):2432. PubMed |
| Vukusic, Kristina; Sandstedt, Mikael; Jonsson, Marianne; Jansson, Märta; Oldfors, Anders; Jeppsson, Anders; Dellgren, Göran; Lindahl, Anders; Sandstedt, Joakim. The Atrioventricular Junction: A Potential Niche Region for Progenitor Cells in the Adult Human Heart. Stem Cells And Development. 2019;28(16):1078-1088. PubMed |
| Bergmann, Olaf; Zdunek, Sofia; Alkass, Kanar; Druid, Henrik; Bernard, Samuel; Frisén, Jonas. Identification of cardiomyocyte nuclei and assessment of ploidy for the analysis of cell turnover. Experimental Cell Research. 2011;317(2):188-94. PubMed |
| Humbert, Melissa C; Weihbrecht, Katie; Searby, Charles C; Li, Yalan; Pope, Robert M; Sheffield, Val C; Seo, Seongjin. ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2012;109(48):19691-6. PubMed |
| Zhang, Yan; Seo, Seongjin; Bhattarai, Sajag; Bugge, Kevin; Searby, Charles C; Zhang, Qihong; Drack, Arlene V; Stone, Edwin M; Sheffield, Val C. BBS mutations modify phenotypic expression of CEP290-related ciliopathies. Human Molecular Genetics. 2014;23(1):40-51. PubMed |
| So, Chun; Seres, K Bianka; Steyer, Anna M; Mönnich, Eike; Clift, Dean; Pejkovska, Anastasija; Möbius, Wiebke; Schuh, Melina. A liquid-like spindle domain promotes acentrosomal spindle assembly in mammalian oocytes. Science (New York, N.y.). 2019;364(6447) PubMed |
| Tan, Chia Yee; Wong, Jing Xuan; Chan, Pui Shi; Tan, Hansen; Liao, Dan; Chen, Weiming; Tan, Lek Wen; Ackers-Johnson, Matthew; Wakimoto, Hiroko; Seidman, Jonathan G; Seidman, Christine E; Lunde, Ida Gjervold; Zhu, Feng; Hu, Qidong; Bian, Jinsong; Wang, Jiong-Wei; Foo, Roger S; Jiang, Jianming. Yin Yang 1 Suppresses Dilated Cardiomyopathy and Cardiac Fibrosis Through Regulation of Bmp7 and Ctgf. Circulation Research. 2019;125(9):834-846. PubMed |
| Hennig, Maria; Ewering, Lea; Pyschny, Simon; Shimoyama, Shinya; Olecka, Maja; Ewald, Dominik; Magarin, Manuela; Uebing, Anselm; Thierfelder, Ludwig; Jux, Christian; Drenckhahn, Jörg-Detlef. Dietary protein restriction throughout intrauterine and postnatal life results in potentially beneficial myocardial tissue remodeling in the adult mouse heart. Scientific Reports. 2019;9(1):15126. PubMed |
| Cui, Miao; Olson, Eric N. Protocol for Single-Nucleus Transcriptomics of Diploid and Tetraploid Cardiomyocytes in Murine Hearts. Star Protocols. 2020;1(2):100049. PubMed |
| Boikova, Aleksandra; Bywater, Megan J; Quaife-Ryan, Gregory A; Straube, Jasmin; Thompson, Lucy; Ascanelli, Camilla; Littlewood, Trevor D; Evan, Gerard I; Hudson, James E; Wilson, Catherine H. HRas and Myc synergistically induce cell cycle progression and apoptosis of murine cardiomyocytes. Frontiers In Cardiovascular Medicine. 9( 36337898):948281. PubMed |