Anti PCM1 pAb (ATL-HPA023370 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023370-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PCM1
Alternative Gene Name: PTC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031592: 78%, ENSRNOG00000010155: 78%
Entrez Gene ID: 5108
Uniprot ID: Q15154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKTQKDT |
| Gene Sequence | EEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKTQKDT |
| Gene ID - Mouse | ENSMUSG00000031592 |
| Gene ID - Rat | ENSRNOG00000010155 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCM1 pAb (ATL-HPA023370 w/enhanced validation) | |
| Datasheet | Anti PCM1 pAb (ATL-HPA023370 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PCM1 pAb (ATL-HPA023370 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PCM1 pAb (ATL-HPA023370 w/enhanced validation) | |
| Datasheet | Anti PCM1 pAb (ATL-HPA023370 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PCM1 pAb (ATL-HPA023370 w/enhanced validation) |
| Citations for Anti PCM1 pAb (ATL-HPA023370 w/enhanced validation) – 31 Found |
| Wei, Ke; Serpooshan, Vahid; Hurtado, Cecilia; Diez-Cuñado, Marta; Zhao, Mingming; Maruyama, Sonomi; Zhu, Wenhong; Fajardo, Giovanni; Noseda, Michela; Nakamura, Kazuto; Tian, Xueying; Liu, Qiaozhen; Wang, Andrew; Matsuura, Yuka; Bushway, Paul; Cai, Wenqing; Savchenko, Alex; Mahmoudi, Morteza; Schneider, Michael D; van den Hoff, Maurice J B; Butte, Manish J; Yang, Phillip C; Walsh, Kenneth; Zhou, Bin; Bernstein, Daniel; Mercola, Mark; Ruiz-Lozano, Pilar. Epicardial FSTL1 reconstitution regenerates the adult mammalian heart. Nature. 2015;525(7570):479-85. PubMed |
| Nixon, Benjamin R; Williams, Alexandra F; Glennon, Michael S; de Feria, Alejandro E; Sebag, Sara C; Baldwin, H Scott; Becker, Jason R. Alterations in sarcomere function modify the hyperplastic to hypertrophic transition phase of mammalian cardiomyocyte development. Jci Insight. 2017;2(4):e90656. PubMed |
| Gupta, Akshari; Tsuchiya, Yuki; Ohta, Midori; Shiratsuchi, Gen; Kitagawa, Daiju. NEK7 is required for G1 progression and procentriole formation. Molecular Biology Of The Cell. 2017;28(15):2123-2134. PubMed |
| Leach, John P; Heallen, Todd; Zhang, Min; Rahmani, Mahdis; Morikawa, Yuka; Hill, Matthew C; Segura, Ana; Willerson, James T; Martin, James F. Hippo pathway deficiency reverses systolic heart failure after infarction. Nature. 2017;550(7675):260-264. PubMed |
| Gilsbach, Ralf; Schwaderer, Martin; Preissl, Sebastian; Grüning, Björn A; Kranzhöfer, David; Schneider, Pedro; Nührenberg, Thomas G; Mulero-Navarro, Sonia; Weichenhan, Dieter; Braun, Christian; Dreßen, Martina; Jacobs, Adam R; Lahm, Harald; Doenst, Torsten; Backofen, Rolf; Krane, Markus; Gelb, Bruce D; Hein, Lutz. Distinct epigenetic programs regulate cardiac myocyte development and disease in the human heart in vivo. Nature Communications. 2018;9(1):391. PubMed |
| Raso, Andrea; Dirkx, Ellen; Sampaio-Pinto, Vasco; El Azzouzi, Hamid; Cubero, Ryan J; Sorensen, Daniel W; Ottaviani, Lara; Olieslagers, Servé; Huibers, Manon M; de Weger, Roel; Siddiqi, Sailay; Moimas, Silvia; Torrini, Consuelo; Zentillin, Lorena; Braga, Luca; Nascimento, Diana S; da Costa Martins, Paula A; van Berlo, Jop H; Zacchigna, Serena; Giacca, Mauro; De Windt, Leon J. A microRNA program regulates the balance between cardiomyocyte hyperplasia and hypertrophy and stimulates cardiac regeneration. Nature Communications. 2021;12(1):4808. PubMed |
| Bengtsen, Mads; Winje, Ivan Myhre; Eftestøl, Einar; Landskron, Johannes; Sun, Chengyi; Nygård, Kamilla; Domanska, Diana; Millay, Douglas P; Meza-Zepeda, Leonardo A; Gundersen, Kristian. Comparing the epigenetic landscape in myonuclei purified with a PCM1 antibody from a fast/glycolytic and a slow/oxidative muscle. Plos Genetics. 2021;17(11):e1009907. PubMed |
| Günthel, Marie; van Duijvenboden, Karel; de Bakker, Dennis E M; Hooijkaas, Ingeborg B; Bakkers, Jeroen; Barnett, Phil; Christoffels, Vincent M. Epigenetic State Changes Underlie Metabolic Switch in Mouse Post-Infarction Border Zone Cardiomyocytes. Journal Of Cardiovascular Development And Disease. 2021;8(11) PubMed |
| Gilsbach, Ralf; Preissl, Sebastian; Grüning, Björn A; Schnick, Tilman; Burger, Lukas; Benes, Vladimir; Würch, Andreas; Bönisch, Ulrike; Günther, Stefan; Backofen, Rolf; Fleischmann, Bernd K; Schübeler, Dirk; Hein, Lutz. Dynamic DNA methylation orchestrates cardiomyocyte development, maturation and disease. Nature Communications. 2014;5( 25335909):5288. PubMed |
| Shiratsuchi, Gen; Takaoka, Katsuyoshi; Ashikawa, Tomoko; Hamada, Hiroshi; Kitagawa, Daiju. RBM14 prevents assembly of centriolar protein complexes and maintains mitotic spindle integrity. The Embo Journal. 2015;34(1):97-114. PubMed |
| Nührenberg, Thomas G; Hammann, Nils; Schnick, Tilman; Preißl, Sebastian; Witten, Anika; Stoll, Monika; Gilsbach, Ralf; Neumann, Franz-Josef; Hein, Lutz. Cardiac Myocyte De Novo DNA Methyltransferases 3a/3b Are Dispensable for Cardiac Function and Remodeling after Chronic Pressure Overload in Mice. Plos One. 10(6):e0131019. PubMed |
| Cheedipudi, Sirisha M; Matkovich, Scot J; Coarfa, Cristian; Hu, Xin; Robertson, Matthew J; Sweet, Mary; Taylor, Matthew; Mestroni, Luisa; Cleveland, Joseph; Willerson, James T; Gurha, Priyatansh; Marian, Ali J. Genomic Reorganization of Lamin-Associated Domains in Cardiac Myocytes Is Associated With Differential Gene Expression and DNA Methylation in Human Dilated Cardiomyopathy. Circulation Research. 2019;124(8):1198-1213. PubMed |
| Monroe, Tanner O; Hill, Matthew C; Morikawa, Yuka; Leach, John P; Heallen, Todd; Cao, Shuyi; Krijger, Peter H L; de Laat, Wouter; Wehrens, Xander H T; Rodney, George G; Martin, James F. YAP Partially Reprograms Chromatin Accessibility to Directly Induce Adult Cardiogenesis In Vivo. Developmental Cell. 2019;48(6):765-779.e7. PubMed |
| Bhattacharyya, Samadrita; Sathe, Adwait A; Bhakta, Minoti; Xing, Chao; Munshi, Nikhil V. PAN-INTACT enables direct isolation of lineage-specific nuclei from fibrous tissues. Plos One. 14(4):e0214677. PubMed |
| van Ouwerkerk, Antoinette F; Bosada, Fernanda M; van Duijvenboden, Karel; Hill, Matthew C; Montefiori, Lindsey E; Scholman, Koen T; Liu, Jia; de Vries, Antoine A F; Boukens, Bastiaan J; Ellinor, Patrick T; Goumans, Marie José T H; Efimov, Igor R; Nobrega, Marcelo A; Barnett, Phil; Martin, James F; Christoffels, Vincent M. Identification of atrial fibrillation associated genes and functional non-coding variants. Nature Communications. 2019;10(1):4755. PubMed |
| Bywater, Megan J; Burkhart, Deborah L; Straube, Jasmin; Sabò, Arianna; Pendino, Vera; Hudson, James E; Quaife-Ryan, Gregory A; Porrello, Enzo R; Rae, James; Parton, Robert G; Kress, Theresia R; Amati, Bruno; Littlewood, Trevor D; Evan, Gerard I; Wilson, Catherine H. Reactivation of Myc transcription in the mouse heart unlocks its proliferative capacity. Nature Communications. 2020;11(1):1827. PubMed |
| Nguyen, Ngoc Uyen Nhi; Canseco, Diana C; Xiao, Feng; Nakada, Yuji; Li, Shujuan; Lam, Nicholas T; Muralidhar, Shalini A; Savla, Jainy J; Hill, Joseph A; Le, Victor; Zidan, Kareem A; El-Feky, Hamed W; Wang, Zhaoning; Ahmed, Mahmoud Salama; Hubbi, Maimon E; Menendez-Montes, Ivan; Moon, Jesung; Ali, Shah R; Le, Victoria; Villalobos, Elisa; Mohamed, Magid S; Elhelaly, Waleed M; Thet, Suwannee; Anene-Nzelu, Chukwuemeka George; Tan, Wilson Lek Wen; Foo, Roger S; Meng, Xun; Kanchwala, Mohammed; Xing, Chao; Roy, Jagoree; Cyert, Martha S; Rothermel, Beverly A; Sadek, Hesham A. A calcineurin-Hoxb13 axis regulates growth mode of mammalian cardiomyocytes. Nature. 2020;582(7811):271-276. PubMed |
| Masschelein, Evi; D'Hulst, Gommaar; Zvick, Joel; Hinte, Laura; Soro-Arnaiz, Inés; Gorski, Tatiane; von Meyenn, Ferdinand; Bar-Nur, Ori; De Bock, Katrien. Exercise promotes satellite cell contribution to myofibers in a load-dependent manner. Skeletal Muscle. 2020;10(1):21. PubMed |
| Lipovsky, Catherine E; Jimenez, Jesus; Guo, Qiusha; Li, Gang; Yin, Tiankai; Hicks, Stephanie C; Bhatnagar, Somya; Takahashi, Kentaro; Zhang, David M; Brumback, Brittany D; Goldsztejn, Uri; Nadadur, Rangarajan D; Perez-Cervantez, Carlos; Moskowitz, Ivan P; Liu, Shaopeng; Zhang, Bo; Rentschler, Stacey L. Chamber-specific transcriptional responses in atrial fibrillation. Jci Insight. 2020;5(18) PubMed |
| Wu, Yahan; Zhou, Liping; Liu, Hongyu; Duan, Ran; Zhou, Huixing; Zhang, Fulei; He, Xiaoyu; Lu, Dongbo; Xiong, Ke; Xiong, Maolin; Zhuang, Jinzhu; Liu, Yi; Li, Li; Liang, Dandan; Chen, Yi-Han. LRP6 downregulation promotes cardiomyocyte proliferation and heart regeneration. Cell Research. 2021;31(4):450-462. PubMed |
| Monroe, Tanner O; Garrett, Melanie E; Kousi, Maria; Rodriguiz, Ramona M; Moon, Sungjin; Bai, Yushi; Brodar, Steven C; Soldano, Karen L; Savage, Jeremiah; Hansen, Thomas F; Muzny, Donna M; Gibbs, Richard A; Barak, Lawrence; Sullivan, Patrick F; Ashley-Koch, Allison E; Sawa, Akira; Wetsel, William C; Werge, Thomas; Katsanis, Nicholas. PCM1 is necessary for focal ciliary integrity and is a candidate for severe schizophrenia. Nature Communications. 2020;11(1):5903. PubMed |
| Yucel, Nora; Axsom, Jessie; Yang, Yifan; Li, Li; Rhoades, Joshua H; Arany, Zoltan. Cardiac endothelial cells maintain open chromatin and expression of cardiomyocyte myofibrillar genes. Elife. 2020;9( 33315013) PubMed |
| Günthel, Marie; van Duijvenboden, Karel; Jeremiasse, Jorn; van den Hoff, Maurice J B; Christoffels, Vincent M. Early Postnatal Cardiac Stress Does Not Influence Ventricular Cardiomyocyte Cell-Cycle Withdrawal. Journal Of Cardiovascular Development And Disease. 2021;8(4) PubMed |
| Donandt, Tina; Hintze, Stefan; Krause, Sabine; Wolf, Eckhard; Schoser, Benedikt; Walter, Maggie C; Meinke, Peter. Isolation and Characterization of Primary DMD Pig Muscle Cells as an In Vitro Model for Preclinical Research on Duchenne Muscular Dystrophy. Life (Basel, Switzerland). 2022;12(10) PubMed |
| Li, Gang; Brumback, Brittany D; Huang, Lei; Zhang, David M; Yin, Tiankai; Lipovsky, Catherine E; Hicks, Stephanie C; Jimenez, Jesus; Boyle, Patrick M; Rentschler, Stacey L. Acute Glycogen Synthase Kinase-3 Inhibition Modulates Human Cardiac Conduction. Jacc. Basic To Translational Science. 2022;7(10):1001-1017. PubMed |
| Pal, Soumojit; Nixon, Benjamin R; Glennon, Michael S; Shridhar, Puneeth; Satterfield, Sidney L; Su, Yan Ru; Becker, Jason R. Replication Stress Response Modifies Sarcomeric Cardiomyopathy Remodeling. Journal Of The American Heart Association. 2021;10(15):e021768. PubMed |
| Cheedipudi, Sirisha M; Fan, Siyang; Rouhi, Leila; Marian, Ali J. Pharmacological suppression of the WNT signaling pathway attenuates age-dependent expression of the phenotype in a mouse model of arrhythmogenic cardiomyopathy. The Journal Of Cardiovascular Aging. 1(3) PubMed |
| Hashimoto, Ken; Kodama, Aya; Ohira, Momoko; Kimoto, Misaki; Nakagawa, Reiko; Usui, Yuu; Ujihara, Yoshihiro; Hanashima, Akira; Mohri, Satoshi. Postnatal expression of cell cycle promoter Fam64a causes heart dysfunction by inhibiting cardiomyocyte differentiation through repression of Klf15. Iscience. 2022;25(5):104337. PubMed |
| Boikova, Aleksandra; Bywater, Megan J; Quaife-Ryan, Gregory A; Straube, Jasmin; Thompson, Lucy; Ascanelli, Camilla; Littlewood, Trevor D; Evan, Gerard I; Hudson, James E; Wilson, Catherine H. HRas and Myc synergistically induce cell cycle progression and apoptosis of murine cardiomyocytes. Frontiers In Cardiovascular Medicine. 9( 36337898):948281. PubMed |
| Sakabe, Masahide; Thompson, Michael; Chen, Nong; Verba, Mark; Hassan, Aishlin; Lu, Richard; Xin, Mei. Inhibition of β1-AR/Gαs signaling promotes cardiomyocyte proliferation in juvenile mice through activation of RhoA-YAP axis. Elife. 2022;11( 36479975) PubMed |
| Bosada, Fernanda M; van Duijvenboden, Karel; Giovou, Alexandra E; Rivaud, Mathilde R; Uhm, Jae-Sun; Verkerk, Arie O; Boukens, Bastiaan J; Christoffels, Vincent M. An atrial fibrillation-associated regulatory region modulates cardiac Tbx5 levels and arrhythmia susceptibility. Elife. 2023;12( 36715501) PubMed |