Anti PCGF2 pAb (ATL-HPA047732)

Atlas Antibodies

Catalog No.: ATL-HPA047732-25

Protein Description: polycomb group ring finger 2
Gene Name: PCGF2
Alternative Gene Name: MEL-18, RNF110, ZNF144
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018537: 87%, ENSRNOG00000012705: 87%
Entrez Gene ID: 7703
Uniprot ID: P35227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCP
• Gene Sequence: SLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCP
• Gene ID - Mouse: ENSMUSG00000018537
• Gene ID - Rat: ENSRNOG00000012705
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.