Anti PCGF2 pAb (ATL-HPA047732)

Atlas Antibodies

Catalog No.:
ATL-HPA047732-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polycomb group ring finger 2
Gene Name: PCGF2
Alternative Gene Name: MEL-18, RNF110, ZNF144
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018537: 87%, ENSRNOG00000012705: 87%
Entrez Gene ID: 7703
Uniprot ID: P35227
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCP
Gene Sequence SLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCP
Gene ID - Mouse ENSMUSG00000018537
Gene ID - Rat ENSRNOG00000012705
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PCGF2 pAb (ATL-HPA047732)
Datasheet Anti PCGF2 pAb (ATL-HPA047732) Datasheet (External Link)
Vendor Page Anti PCGF2 pAb (ATL-HPA047732) at Atlas Antibodies

Documents & Links for Anti PCGF2 pAb (ATL-HPA047732)
Datasheet Anti PCGF2 pAb (ATL-HPA047732) Datasheet (External Link)
Vendor Page Anti PCGF2 pAb (ATL-HPA047732)