Anti PCDHB14 pAb (ATL-HPA007692)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007692-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PCDHB14
Alternative Gene Name: PCDH-BETA14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046191: 82%, ENSRNOG00000033123: 80%
Entrez Gene ID: 56122
Uniprot ID: Q9Y5E9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RKTFEINPISGEVNLRSPLDFEVIQSYTINIQATDGGGLSGKCTLLVKVMDINDNPPEVTISSITKRIPENASETLVALFSILDQDSGDNGRMICSIQDNLP |
| Gene Sequence | RKTFEINPISGEVNLRSPLDFEVIQSYTINIQATDGGGLSGKCTLLVKVMDINDNPPEVTISSITKRIPENASETLVALFSILDQDSGDNGRMICSIQDNLP |
| Gene ID - Mouse | ENSMUSG00000046191 |
| Gene ID - Rat | ENSRNOG00000033123 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PCDHB14 pAb (ATL-HPA007692) | |
| Datasheet | Anti PCDHB14 pAb (ATL-HPA007692) Datasheet (External Link) |
| Vendor Page | Anti PCDHB14 pAb (ATL-HPA007692) at Atlas Antibodies |
| Documents & Links for Anti PCDHB14 pAb (ATL-HPA007692) | |
| Datasheet | Anti PCDHB14 pAb (ATL-HPA007692) Datasheet (External Link) |
| Vendor Page | Anti PCDHB14 pAb (ATL-HPA007692) |