Anti PAX6 pAb (ATL-HPA030775)

Atlas Antibodies

Catalog No.: ATL-HPA030775-25

Protein Description: paired box 6
Gene Name: PAX6
Alternative Gene Name: AN, AN2, D11S812E, WAGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027168: 100%, ENSRNOG00000004410: 100%
Entrez Gene ID: 5080
Uniprot ID: P26367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW
• Gene Sequence: VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW
• Gene ID - Mouse: ENSMUSG00000027168
• Gene ID - Rat: ENSRNOG00000004410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PAX6 pAb (ATL-HPA030775) – 9 Found

Zhang, Zhen-Ning; Freitas, Beatriz C; Qian, Hao; Lux, Jacques; Acab, Allan; Trujillo, Cleber A; Herai, Roberto H; Nguyen Huu, Viet Anh; Wen, Jessica H; Joshi-Barr, Shivanjali; Karpiak, Jerome V; Engler, Adam J; Fu, Xiang-Dong; Muotri, Alysson R; Almutairi, Adah. Layered hydrogels accelerate iPSC-derived neuronal maturation and reveal migration defects caused by MeCP2 dysfunction. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(12):3185-90. 

Fujiwara, Nana; Cave, John W. Partial Conservation between Mice and Humans in Olfactory Bulb Interneuron Transcription Factor Codes. Frontiers In Neuroscience. 10( 27489533):337. 

Hoelzl, Maria A; Heby-Henricson, Karin; Gerling, Marco; Dias, José M; Kuiper, Raoul V; Trünkle, Cornelius; Bergström, Åsa; Ericson, Johan; Toftgård, Rune; Teglund, Stephan. Differential requirement of SUFU in tissue development discovered in a hypomorphic mouse model. Developmental Biology. 2017;429(1):132-146. 

Tang, Yu; Liu, Meng-Lu; Zang, Tong; Zhang, Chun-Li. Direct Reprogramming Rather than iPSC-Based Reprogramming Maintains Aging Hallmarks in Human Motor Neurons. Frontiers In Molecular Neuroscience. 10( 29163034):359. 

Vattulainen, Meri; Ilmarinen, Tanja; Viheriälä, Taina; Jokinen, Vilma; Skottman, Heli. Corneal epithelial differentiation of human pluripotent stem cells generates ABCB5(+) and ∆Np63α(+) cells with limbal cell characteristics and high wound healing capacity. Stem Cell Research & Therapy. 2021;12(1):609. 

Johnson Chacko, Lejo; Pechriggl, Elisabeth J; Fritsch, Helga; Rask-Andersen, Helge; Blumer, Michael J F; Schrott-Fischer, Anneliese; Glueckert, Rudolf. Neurosensory Differentiation and Innervation Patterning in the Human Fetal Vestibular End Organs between the Gestational Weeks 8-12. Frontiers In Neuroanatomy. 10( 27895556):111. 

Li, Qiuhong; Huang, Qingsong. Single-cell qPCR demonstrates that Repsox treatment changes cell fate from endoderm to neuroectoderm and disrupts epithelial-mesenchymal transition. Plos One. 14(10):e0223724. 

Grönroos, Pyry; Ilmarinen, Tanja; Skottman, Heli. Directed Differentiation of Human Pluripotent Stem Cells towards Corneal Endothelial-Like Cells under Defined Conditions. Cells. 2021;10(2) 

Brighi, Carlo; Salaris, Federico; Soloperto, Alessandro; Cordella, Federica; Ghirga, Silvia; de Turris, Valeria; Rosito, Maria; Porceddu, Pier Francesca; D'Antoni, Chiara; Reggiani, Angelo; Rosa, Alessandro; Di Angelantonio, Silvia. Novel fragile X syndrome 2D and 3D brain models based on human isogenic FMRP-KO iPSCs. Cell Death & Disease. 2021;12(5):498.