Anti PARVG pAb (ATL-HPA031834)

Atlas Antibodies

Catalog No.:
ATL-HPA031834-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: parvin, gamma
Gene Name: PARVG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022439: 74%, ENSRNOG00000052064: 76%
Entrez Gene ID: 64098
Uniprot ID: Q9HBI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
Gene Sequence LHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
Gene ID - Mouse ENSMUSG00000022439
Gene ID - Rat ENSRNOG00000052064
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PARVG pAb (ATL-HPA031834)
Datasheet Anti PARVG pAb (ATL-HPA031834) Datasheet (External Link)
Vendor Page Anti PARVG pAb (ATL-HPA031834) at Atlas Antibodies

Documents & Links for Anti PARVG pAb (ATL-HPA031834)
Datasheet Anti PARVG pAb (ATL-HPA031834) Datasheet (External Link)
Vendor Page Anti PARVG pAb (ATL-HPA031834)