Anti PARVA pAb (ATL-HPA005964)

Atlas Antibodies

Catalog No.: ATL-HPA005964-25

Protein Description: parvin, alpha
Gene Name: PARVA
Alternative Gene Name: FLJ10793, FLJ12254, MXRA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030770: 98%, ENSRNOG00000015713: 98%
Entrez Gene ID: 55742
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLP
• Gene Sequence: QEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLP
• Gene ID - Mouse: ENSMUSG00000030770
• Gene ID - Rat: ENSRNOG00000015713
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PARVA pAb (ATL-HPA005964) – 2 Found

Tsinias, Georgios; Nikou, Sofia; Papadas, Theodoros; Pitsos, Panagiotis; Papadaki, Helen; Bravou, Vasiliki. High PINCH1 Expression in Human Laryngeal Carcinoma Associates with Poor Prognosis. Analytical Cellular Pathology (Amsterdam). 2018( 29755929):2989635. 

Zhang, Rui; Zhang, Tong-Tong; Zhai, Gao-Qiang; Guo, Xian-Yu; Qin, Yuan; Gan, Ting-Qing; Zhang, Yu; Chen, Gang; Mo, Wei-Jia; Feng, Zhen-Bo. Evaluation of the HOXA11 level in patients with lung squamous cancer and insights into potential molecular pathways via bioinformatics analysis. World Journal Of Surgical Oncology. 2018;16(1):109.