Anti PARS2 pAb (ATL-HPA028308)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028308-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PARS2
Alternative Gene Name: DKFZp727A071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043572: 78%, ENSRNOG00000007327: 78%
Entrez Gene ID: 25973
Uniprot ID: Q7L3T8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RFHHCAPRRGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVI |
| Gene Sequence | RFHHCAPRRGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVI |
| Gene ID - Mouse | ENSMUSG00000043572 |
| Gene ID - Rat | ENSRNOG00000007327 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PARS2 pAb (ATL-HPA028308) | |
| Datasheet | Anti PARS2 pAb (ATL-HPA028308) Datasheet (External Link) |
| Vendor Page | Anti PARS2 pAb (ATL-HPA028308) at Atlas Antibodies |
| Documents & Links for Anti PARS2 pAb (ATL-HPA028308) | |
| Datasheet | Anti PARS2 pAb (ATL-HPA028308) Datasheet (External Link) |
| Vendor Page | Anti PARS2 pAb (ATL-HPA028308) |