Anti PARS2 pAb (ATL-HPA028308)

Atlas Antibodies

Catalog No.:
ATL-HPA028308-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: prolyl-tRNA synthetase 2, mitochondrial (putative)
Gene Name: PARS2
Alternative Gene Name: DKFZp727A071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043572: 78%, ENSRNOG00000007327: 78%
Entrez Gene ID: 25973
Uniprot ID: Q7L3T8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RFHHCAPRRGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVI
Gene Sequence RFHHCAPRRGRRLLLSRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVI
Gene ID - Mouse ENSMUSG00000043572
Gene ID - Rat ENSRNOG00000007327
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PARS2 pAb (ATL-HPA028308)
Datasheet Anti PARS2 pAb (ATL-HPA028308) Datasheet (External Link)
Vendor Page Anti PARS2 pAb (ATL-HPA028308) at Atlas Antibodies

Documents & Links for Anti PARS2 pAb (ATL-HPA028308)
Datasheet Anti PARS2 pAb (ATL-HPA028308) Datasheet (External Link)
Vendor Page Anti PARS2 pAb (ATL-HPA028308)