Anti PARP6 pAb (ATL-HPA026991)

Atlas Antibodies

Catalog No.: ATL-HPA026991-25

Protein Description: poly (ADP-ribose) polymerase family, member 6
Gene Name: PARP6
Alternative Gene Name: pART17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025237: 100%, ENSRNOG00000011199: 100%
Entrez Gene ID: 56965
Uniprot ID: Q2NL67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHG
• Gene Sequence: QLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHG
• Gene ID - Mouse: ENSMUSG00000025237
• Gene ID - Rat: ENSRNOG00000011199
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PARP6 pAb (ATL-HPA026991) – 2 Found

Qi, Guangying; Kudo, Yasusei; Tang, Bo; Liu, Tian; Jin, Shengjian; Liu, Jing; Zuo, Xiaoxu; Mi, Sisi; Shao, Wenhuan; Ma, Xiaojuan; Tsunematsu, Takaaki; Ishimaru, Naozumi; Zeng, Sien; Tatsuka, Masaaki; Shimamoto, Fumio. PARP6 acts as a tumor suppressor via downregulating Survivin expression in colorectal cancer. Oncotarget. 2016;7(14):18812-24. 

Huang, Jeffrey Y; Wang, Kang; Vermehren-Schmaedick, Anke; Adelman, John P; Cohen, Michael S. PARP6 is a Regulator of Hippocampal Dendritic Morphogenesis. Scientific Reports. 2016;6( 26725726):18512.