Anti PARP6 pAb (ATL-HPA026991)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026991-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PARP6
Alternative Gene Name: pART17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025237: 100%, ENSRNOG00000011199: 100%
Entrez Gene ID: 56965
Uniprot ID: Q2NL67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHG |
| Gene Sequence | QLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHG |
| Gene ID - Mouse | ENSMUSG00000025237 |
| Gene ID - Rat | ENSRNOG00000011199 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PARP6 pAb (ATL-HPA026991) | |
| Datasheet | Anti PARP6 pAb (ATL-HPA026991) Datasheet (External Link) |
| Vendor Page | Anti PARP6 pAb (ATL-HPA026991) at Atlas Antibodies |
| Documents & Links for Anti PARP6 pAb (ATL-HPA026991) | |
| Datasheet | Anti PARP6 pAb (ATL-HPA026991) Datasheet (External Link) |
| Vendor Page | Anti PARP6 pAb (ATL-HPA026991) |
| Citations for Anti PARP6 pAb (ATL-HPA026991) – 2 Found |
| Qi, Guangying; Kudo, Yasusei; Tang, Bo; Liu, Tian; Jin, Shengjian; Liu, Jing; Zuo, Xiaoxu; Mi, Sisi; Shao, Wenhuan; Ma, Xiaojuan; Tsunematsu, Takaaki; Ishimaru, Naozumi; Zeng, Sien; Tatsuka, Masaaki; Shimamoto, Fumio. PARP6 acts as a tumor suppressor via downregulating Survivin expression in colorectal cancer. Oncotarget. 2016;7(14):18812-24. PubMed |
| Huang, Jeffrey Y; Wang, Kang; Vermehren-Schmaedick, Anke; Adelman, John P; Cohen, Michael S. PARP6 is a Regulator of Hippocampal Dendritic Morphogenesis. Scientific Reports. 2016;6( 26725726):18512. PubMed |