Anti PARP14 pAb (ATL-HPA012063)

Atlas Antibodies

Catalog No.: ATL-HPA012063-25

Protein Description: poly (ADP-ribose) polymerase family, member 14
Gene Name: PARP14
Alternative Gene Name: KIAA1268, pART8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034422: 56%, ENSRNOG00000023334: 53%
Entrez Gene ID: 54625
Uniprot ID: Q460N5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCS
• Gene Sequence: AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCS
• Gene ID - Mouse: ENSMUSG00000034422
• Gene ID - Rat: ENSRNOG00000023334
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PARP14 pAb (ATL-HPA012063) – 6 Found

Iansante, Valeria; Choy, Pui Man; Fung, Sze Wai; Liu, Ying; Chai, Jian-Guo; Dyson, Julian; Del Rio, Alberto; D'Santos, Clive; Williams, Roger; Chokshi, Shilpa; Anders, Robert A; Bubici, Concetta; Papa, Salvatore. PARP14 promotes the Warburg effect in hepatocellular carcinoma by inhibiting JNK1-dependent PKM2 phosphorylation and activation. Nature Communications. 2015;6( 26258887):7882. 

Yumnam, Silvia; Raha, Suchismita; Kim, Seong Min; Venkatarame Gowda Saralamma, Venu; Lee, Ho Jeong; Ha, Sang Eun; Heo, Jeong Doo; Lee, Sang Joon; Kim, Eun Hee; Lee, Won Sup; Kim, Jin A; Kim, Gon Sup. Identification of a novel biomarker in tangeretin‑induced cell death in AGS human gastric cancer cells. Oncology Reports. 2018;40(6):3249-3260. 

Grunewald, Matthew E; Chen, Yating; Kuny, Chad; Maejima, Takashi; Lease, Robert; Ferraris, Dana; Aikawa, Masanori; Sullivan, Christopher S; Perlman, Stanley; Fehr, Anthony R. The coronavirus macrodomain is required to prevent PARP-mediated inhibition of virus replication and enhancement of IFN expression. Plos Pathogens. 2019;15(5):e1007756. 

Vyas, Sejal; Chesarone-Cataldo, Melissa; Todorova, Tanya; Huang, Yun-Han; Chang, Paul. A systematic analysis of the PARP protein family identifies new functions critical for cell physiology. Nature Communications. 4( 23917125):2240. 

Mentz, Michael; Keay, William; Strobl, Carolin Dorothea; Antoniolli, Martina; Adolph, Louisa; Heide, Michael; Lechner, Axel; Haebe, Sarah; Osterode, Elisa; Kridel, Robert; Ziegenhain, Christoph; Wange, Lucas Esteban; Hildebrand, Johannes Adrian; Shree, Tanaya; Silkenstedt, Elisabeth; Staiger, Annette M; Ott, German; Horn, Heike; Szczepanowski, Monika; Richter, Julia; Levy, Ronald; Rosenwald, Andreas; Enard, Wolfgang; Zimber-Strobl, Ursula; von Bergwelt-Baildon, Michael; Hiddemann, Wolfgang; Klapper, Wolfram; Schmidt-Supprian, Marc; Rudelius, Martina; Bararia, Deepak; Passerini, Verena; Weigert, Oliver. PARP14 is a novel target in STAT6 mutant follicular lymphoma. Leukemia. 2022;36(9):2281-2292. 

Tang, Ying; Liu, Jinchang; Wang, Yu; Yang, Li; Han, Bing; Zhang, Yuan; Bai, Ying; Shen, Ling; Li, Mingyue; Jiang, Teng; Ye, Qingqing; Yu, Xiaoyu; Huang, Rongrong; Zhang, Zhao; Xu, Yungen; Yao, Honghong. PARP14 inhibits microglial activation via LPAR5 to promote post-stroke functional recovery. Autophagy. 2021;17(10):2905-2922.