Anti PARM1 pAb (ATL-HPA038236)

Atlas Antibodies

Catalog No.: ATL-HPA038236-25

Protein Description: prostate androgen-regulated mucin-like protein 1
Gene Name: PARM1
Alternative Gene Name: Cipar1, DKFZP564O0823, WSC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034981: 44%, ENSRNOG00000002579: 47%
Entrez Gene ID: 25849
Uniprot ID: Q6UWI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT
• Gene Sequence: VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT
• Gene ID - Mouse: ENSMUSG00000034981
• Gene ID - Rat: ENSRNOG00000002579
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PARM1 pAb (ATL-HPA038236) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.