Anti PAQR6 pAb (ATL-HPA073505)

Atlas Antibodies

Catalog No.:
ATL-HPA073505-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: progestin and adipoQ receptor family member VI
Gene Name: PAQR6
Alternative Gene Name: FLJ22672, PRdelta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029675: 26%, ENSRNOG00000009723: 26%
Entrez Gene ID: 79957
Uniprot ID: Q6TCH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL
Gene Sequence YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL
Gene ID - Mouse ENSMUSG00000029675
Gene ID - Rat ENSRNOG00000009723
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAQR6 pAb (ATL-HPA073505)
Datasheet Anti PAQR6 pAb (ATL-HPA073505) Datasheet (External Link)
Vendor Page Anti PAQR6 pAb (ATL-HPA073505) at Atlas Antibodies

Documents & Links for Anti PAQR6 pAb (ATL-HPA073505)
Datasheet Anti PAQR6 pAb (ATL-HPA073505) Datasheet (External Link)
Vendor Page Anti PAQR6 pAb (ATL-HPA073505)