Anti PAPPA pAb (ATL-HPA001667 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001667-25

Protein Description: pregnancy-associated plasma protein A, pappalysin 1
Gene Name: PAPPA
Alternative Gene Name: ASBABP2, DIPLA1, IGFBP-4ase, PAPA, PAPP-A, PAPPA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028370: 92%, ENSRNOG00000033527: 92%
Entrez Gene ID: 5069
Uniprot ID: Q13219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDL
• Gene Sequence: SCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDL
• Gene ID - Mouse: ENSMUSG00000028370
• Gene ID - Rat: ENSRNOG00000033527
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PAPPA pAb (ATL-HPA001667 w/enhanced validation) – 3 Found

Kirschner, Andreas; Thiede, Melanie; Grünewald, Thomas G P; Alba Rubio, Rebeca; Richter, Günther H S; Kirchner, Thomas; Busch, Dirk H; Burdach, Stefan; Thiel, Uwe. Pappalysin-1 T cell receptor transgenic allo-restricted T cells kill Ewing sarcoma in vitro and in vivo. Oncoimmunology. 6(2):e1273301. 

Fan, Shi-Yuan; Chiu, Nan-Fu; Chen, Chie-Pein; Chang, Chia-Chen; Chen, Chen-Yu. Simultaneous Real-Time Detection of Pregnancy-Associated Plasma Protein-A and -A2 Using a Graphene Oxide-Based Surface Plasmon Resonance Biosensor. International Journal Of Nanomedicine. 15( 32273704):2085-2094. 

Zhang, Jun; Zhang, Yuan; Li, Lanjiang; Nian, Yinghua; Chen, Ying; Shen, Ruoxia; Ma, Xiaoyan. Pregnancy-associated plasma protein-A (PAPPA) promotes breast cancer progression. Bioengineered. 2022;13(1):291-307.