Anti PAPOLB pAb (ATL-HPA047285)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047285-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PAPOLB
Alternative Gene Name: PAPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074817: 52%, ENSRNOG00000004827: 42%
Entrez Gene ID: 56903
Uniprot ID: Q9NRJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL |
Gene Sequence | SLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL |
Gene ID - Mouse | ENSMUSG00000074817 |
Gene ID - Rat | ENSRNOG00000004827 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PAPOLB pAb (ATL-HPA047285) | |
Datasheet | Anti PAPOLB pAb (ATL-HPA047285) Datasheet (External Link) |
Vendor Page | Anti PAPOLB pAb (ATL-HPA047285) at Atlas Antibodies |
Documents & Links for Anti PAPOLB pAb (ATL-HPA047285) | |
Datasheet | Anti PAPOLB pAb (ATL-HPA047285) Datasheet (External Link) |
Vendor Page | Anti PAPOLB pAb (ATL-HPA047285) |