Anti PAPOLB pAb (ATL-HPA047285)

Atlas Antibodies

Catalog No.:
ATL-HPA047285-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: poly(A) polymerase beta
Gene Name: PAPOLB
Alternative Gene Name: PAPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074817: 52%, ENSRNOG00000004827: 42%
Entrez Gene ID: 56903
Uniprot ID: Q9NRJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL
Gene Sequence SLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL
Gene ID - Mouse ENSMUSG00000074817
Gene ID - Rat ENSRNOG00000004827
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAPOLB pAb (ATL-HPA047285)
Datasheet Anti PAPOLB pAb (ATL-HPA047285) Datasheet (External Link)
Vendor Page Anti PAPOLB pAb (ATL-HPA047285) at Atlas Antibodies

Documents & Links for Anti PAPOLB pAb (ATL-HPA047285)
Datasheet Anti PAPOLB pAb (ATL-HPA047285) Datasheet (External Link)
Vendor Page Anti PAPOLB pAb (ATL-HPA047285)