Anti PAPD5 pAb (ATL-HPA048225)

Atlas Antibodies

Catalog No.:
ATL-HPA048225-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: PAP associated domain containing 5
Gene Name: PAPD5
Alternative Gene Name: TRF4-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036779: 95%, ENSRNOG00000024212: 94%
Entrez Gene ID: 64282
Uniprot ID: Q8NDF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVS
Gene Sequence YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVS
Gene ID - Mouse ENSMUSG00000036779
Gene ID - Rat ENSRNOG00000024212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAPD5 pAb (ATL-HPA048225)
Datasheet Anti PAPD5 pAb (ATL-HPA048225) Datasheet (External Link)
Vendor Page Anti PAPD5 pAb (ATL-HPA048225) at Atlas Antibodies

Documents & Links for Anti PAPD5 pAb (ATL-HPA048225)
Datasheet Anti PAPD5 pAb (ATL-HPA048225) Datasheet (External Link)
Vendor Page Anti PAPD5 pAb (ATL-HPA048225)