Anti PAPD5 pAb (ATL-HPA048225)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048225-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PAPD5
Alternative Gene Name: TRF4-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036779: 95%, ENSRNOG00000024212: 94%
Entrez Gene ID: 64282
Uniprot ID: Q8NDF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVS |
| Gene Sequence | YYPNNETESILGRIIRVTDEVATYRDWISKQWGLKNRPEPSCNGNGVTLIVDTQQLDKCNNNLSEENEALGKCRSKTSESLSKHSSNSSSGPVS |
| Gene ID - Mouse | ENSMUSG00000036779 |
| Gene ID - Rat | ENSRNOG00000024212 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAPD5 pAb (ATL-HPA048225) | |
| Datasheet | Anti PAPD5 pAb (ATL-HPA048225) Datasheet (External Link) |
| Vendor Page | Anti PAPD5 pAb (ATL-HPA048225) at Atlas Antibodies |
| Documents & Links for Anti PAPD5 pAb (ATL-HPA048225) | |
| Datasheet | Anti PAPD5 pAb (ATL-HPA048225) Datasheet (External Link) |
| Vendor Page | Anti PAPD5 pAb (ATL-HPA048225) |