Anti PAK1IP1 pAb (ATL-HPA030112)

Atlas Antibodies

Catalog No.: ATL-HPA030112-25

Protein Description: PAK1 interacting protein 1
Gene Name: PAK1IP1
Alternative Gene Name: bA421M1.5, FLJ20624, hPIP1, MAK11, PIP1, WDR84
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038683: 51%, ENSRNOG00000023799: 43%
Entrez Gene ID: 55003
Uniprot ID: Q9NWT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKES
• Gene Sequence: VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKES
• Gene ID - Mouse: ENSMUSG00000038683
• Gene ID - Rat: ENSRNOG00000023799
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.