Anti PAK1 pAb (ATL-HPA003565 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003565-25

Protein Description: p21 protein (Cdc42/Rac)-activated kinase 1
Gene Name: PAK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030774: 97%, ENSRNOG00000029784: 97%
Entrez Gene ID: 5058
Uniprot ID: Q13153
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEE
• Gene Sequence: NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEE
• Gene ID - Mouse: ENSMUSG00000030774
• Gene ID - Rat: ENSRNOG00000029784
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PAK1 pAb (ATL-HPA003565 w/enhanced validation) – 2 Found

Geiger, Tamar; Velic, Ana; Macek, Boris; Lundberg, Emma; Kampf, Caroline; Nagaraj, Nagarjuna; Uhlen, Mathias; Cox, Juergen; Mann, Matthias. Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse. Molecular & Cellular Proteomics : Mcp. 2013;12(6):1709-22. 

Ahn, Miwon; Oh, Eunjin; McCown, Erika M; Wang, Xin; Veluthakal, Rajakrishnan; Thurmond, Debbie C. A requirement for PAK1 to support mitochondrial function and maintain cellular redox balance via electron transport chain proteins to prevent β-cell apoptosis. Metabolism: Clinical And Experimental. 2021;115( 33181191):154431.