Anti PAGR1 pAb (ATL-HPA041440)

Atlas Antibodies

Catalog No.: ATL-HPA041440-25

Protein Description: PAXIP1 associated glutamate-rich protein 1
Gene Name: PAGR1
Alternative Gene Name: C16orf53, GAS, MGC4606, PA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030680: 89%, ENSRNOG00000020217: 91%
Entrez Gene ID: 79447
Uniprot ID: Q9BTK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPEAQSEEERSDEEPEA
• Gene Sequence: PAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPEAQSEEERSDEEPEA
• Gene ID - Mouse: ENSMUSG00000030680
• Gene ID - Rat: ENSRNOG00000020217
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.