Anti PAGR1 pAb (ATL-HPA041440)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041440-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PAGR1
Alternative Gene Name: C16orf53, GAS, MGC4606, PA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030680: 89%, ENSRNOG00000020217: 91%
Entrez Gene ID: 79447
Uniprot ID: Q9BTK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPEAQSEEERSDEEPEA |
| Gene Sequence | PAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPEAQSEEERSDEEPEA |
| Gene ID - Mouse | ENSMUSG00000030680 |
| Gene ID - Rat | ENSRNOG00000020217 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAGR1 pAb (ATL-HPA041440) | |
| Datasheet | Anti PAGR1 pAb (ATL-HPA041440) Datasheet (External Link) |
| Vendor Page | Anti PAGR1 pAb (ATL-HPA041440) at Atlas Antibodies |
| Documents & Links for Anti PAGR1 pAb (ATL-HPA041440) | |
| Datasheet | Anti PAGR1 pAb (ATL-HPA041440) Datasheet (External Link) |
| Vendor Page | Anti PAGR1 pAb (ATL-HPA041440) |