Anti PAGE4 pAb (ATL-HPA023880 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023880-25
Immunohistochemistry analysis in human placenta and endometrium tissues using Anti-PAGE4 antibody. Corresponding PAGE4 RNA-seq data are presented for the same tissues.
ChIP-Exo-Seq composite graph for Anti-PAGE4 (HPA023880, Lot A104867) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: P antigen family, member 4 (prostate associated)
Gene Name: PAGE4
Alternative Gene Name: CT16.7, GAGEC1, PAGE-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029423: 25%, ENSRNOG00000011653: 27%
Entrez Gene ID: 9506
Uniprot ID: O60829
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Gene Sequence DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP
Gene ID - Mouse ENSMUSG00000029423
Gene ID - Rat ENSRNOG00000011653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PAGE4 pAb (ATL-HPA023880 w/enhanced validation)
Datasheet Anti PAGE4 pAb (ATL-HPA023880 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PAGE4 pAb (ATL-HPA023880 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PAGE4 pAb (ATL-HPA023880 w/enhanced validation)
Datasheet Anti PAGE4 pAb (ATL-HPA023880 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PAGE4 pAb (ATL-HPA023880 w/enhanced validation)
Citations for Anti PAGE4 pAb (ATL-HPA023880 w/enhanced validation) – 2 Found
Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244.  PubMed
Marsh, Bryan; Zhou, Yan; Kapidzic, Mirhan; Fisher, Susan; Blelloch, Robert. Regionally distinct trophoblast regulate barrier function and invasion in the human placenta. Elife. 2022;11( 35796428)  PubMed
!