Anti PAFAH1B1 pAb (ATL-HPA020036 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020036-25

Protein Description: platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
Gene Name: PAFAH1B1
Alternative Gene Name: LIS1, MDCR, MDS, PAFAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020745: 99%, ENSRNOG00000002755: 99%
Entrez Gene ID: 5048
Uniprot ID: P43034
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS
• Gene Sequence: ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS
• Gene ID - Mouse: ENSMUSG00000020745
• Gene ID - Rat: ENSRNOG00000002755
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.