Anti PAEP pAb (ATL-HPA029473 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029473-25

Protein Description: progestagen-associated endometrial protein
Gene Name: PAEP
Alternative Gene Name: GD, GdA, GdF, GdS, MGC138509, MGC142288, PAEG, PEP, PP14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062061: 29%, ENSRNOG00000027821: 29%
Entrez Gene ID: 5047
Uniprot ID: P09466
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKI
• Gene Sequence: QDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKI
• Gene ID - Mouse: ENSMUSG00000062061
• Gene ID - Rat: ENSRNOG00000027821
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PAEP pAb (ATL-HPA029473 w/enhanced validation) – 1 Found

Qundos, Ulrika; Drobin, Kimi; Mattsson, Cecilia; Hong, Mun-Gwan; Sjöberg, Ronald; Forsström, Björn; Solomon, David; Uhlén, Mathias; Nilsson, Peter; Michaëlsson, Karl; Schwenk, Jochen M. Affinity proteomics discovers decreased levels of AMFR in plasma from Osteoporosis patients. Proteomics. Clinical Applications. 2016;10(6):681-90.