Anti PACSIN1 pAb (ATL-HPA028852 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028852-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: protein kinase C and casein kinase substrate in neurons 1
Gene Name: PACSIN1
Alternative Gene Name: SDPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040276: 99%, ENSRNOG00000054603: 100%
Entrez Gene ID: 29993
Uniprot ID: Q9BY11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNW
Gene Sequence FEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNW
Gene ID - Mouse ENSMUSG00000040276
Gene ID - Rat ENSRNOG00000054603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PACSIN1 pAb (ATL-HPA028852 w/enhanced validation)
Datasheet Anti PACSIN1 pAb (ATL-HPA028852 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PACSIN1 pAb (ATL-HPA028852 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PACSIN1 pAb (ATL-HPA028852 w/enhanced validation)
Datasheet Anti PACSIN1 pAb (ATL-HPA028852 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PACSIN1 pAb (ATL-HPA028852 w/enhanced validation)
Citations for Anti PACSIN1 pAb (ATL-HPA028852 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed