Anti P2RY8 pAb (ATL-HPA003631 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003631-25

Protein Description: purinergic receptor P2Y, G-protein coupled, 8
Gene Name: P2RY8
Alternative Gene Name: P2Y8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021678: 28%, ENSRNOG00000018003: 29%
Entrez Gene ID: 286530
Uniprot ID: Q86VZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
• Gene Sequence: GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF
• Gene ID - Mouse: ENSMUSG00000021678
• Gene ID - Rat: ENSRNOG00000018003
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti P2RY8 pAb (ATL-HPA003631 w/enhanced validation) – 1 Found

Gallman, Antonia E; Wolfreys, Finn D; Nguyen, David N; Sandy, Moriah; Xu, Ying; An, Jinping; Li, Zhongmei; Marson, Alexander; Lu, Erick; Cyster, Jason G. Abcc1 and Ggt5 support lymphocyte guidance through export and catabolism of S-geranylgeranyl-l-glutathione. Science Immunology. 2021;6(60)