Anti OXNAD1 pAb (ATL-HPA036830)

Atlas Antibodies

Catalog No.:
ATL-HPA036830-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: oxidoreductase NAD-binding domain containing 1
Gene Name: OXNAD1
Alternative Gene Name: MGC15763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021906: 85%, ENSRNOG00000019760: 89%
Entrez Gene ID: 92106
Uniprot ID: Q96HP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFD
Gene Sequence SFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFD
Gene ID - Mouse ENSMUSG00000021906
Gene ID - Rat ENSRNOG00000019760
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OXNAD1 pAb (ATL-HPA036830)
Datasheet Anti OXNAD1 pAb (ATL-HPA036830) Datasheet (External Link)
Vendor Page Anti OXNAD1 pAb (ATL-HPA036830) at Atlas Antibodies

Documents & Links for Anti OXNAD1 pAb (ATL-HPA036830)
Datasheet Anti OXNAD1 pAb (ATL-HPA036830) Datasheet (External Link)
Vendor Page Anti OXNAD1 pAb (ATL-HPA036830)