Anti OTX2 pAb (ATL-HPA000633)

Atlas Antibodies

Catalog No.: ATL-HPA000633-25

Protein Description: orthodenticle homeobox 2
Gene Name: OTX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021848: 100%, ENSRNOG00000056186: 100%
Entrez Gene ID: 5015
Uniprot ID: P32243
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYK
• Gene Sequence: SSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYK
• Gene ID - Mouse: ENSMUSG00000021848
• Gene ID - Rat: ENSRNOG00000056186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OTX2 pAb (ATL-HPA000633) – 5 Found

Glubrecht, Darryl D; Kim, Ji-Hyeon; Russell, Laurie; Bamforth, J Stephen; Godbout, Roseline. Differential CRX and OTX2 expression in human retina and retinoblastoma. Journal Of Neurochemistry. 2009;111(1):250-63. 

Karbalaie, Khadijeh; Tanhaei, Somayyeh; Rabiei, Farzaneh; Kiani-Esfahani, Abbas; Masoudi, Najmeh Sadat; Nasr-Esfahani, Mohammad Hossein; Baharvand, Hossein. Stem cells from human exfoliated deciduous tooth exhibit stromal-derived inducing activity and lead to generation of neural crest cells from human embryonic stem cells. Cell Journal. 2015;17(1):37-48. 

Petkov, Stoyan; Dressel, Ralf; Rodriguez-Polo, Ignacio; Behr, Rüdiger. Controlling the Switch from Neurogenesis to Pluripotency during Marmoset Monkey Somatic Cell Reprogramming with Self-Replicating mRNAs and Small Molecules. Cells. 2020;9(11) 

Zhang, Hang; Su, Bingnan; Jiao, Luyan; Xu, Ze-Hua; Zhang, Chang-Jun; Nie, Jinfu; Gao, Mei-Ling; Zhang, Ying V; Jin, Zi-Bing. Transplantation of GMP-grade human iPSC-derived retinal pigment epithelial cells in rodent model: the first pre-clinical study for safety and efficacy in China. Annals Of Translational Medicine. 2021;9(3):245. 

Wu, Fuguo; Bard, Jonathan E; Kann, Julien; Yergeau, Donald; Sapkota, Darshan; Ge, Yichen; Hu, Zihua; Wang, Jie; Liu, Tao; Mu, Xiuqian. Single cell transcriptomics reveals lineage trajectory of retinal ganglion cells in wild-type and Atoh7-null retinas. Nature Communications. 2021;12(1):1465.