Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051074-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: OTULIN
Alternative Gene Name: FAM105B, FLJ34884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046034: 93%, ENSRNOG00000012017: 89%
Entrez Gene ID: 90268
Uniprot ID: Q96BN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP |
| Gene Sequence | DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP |
| Gene ID - Mouse | ENSMUSG00000046034 |
| Gene ID - Rat | ENSRNOG00000012017 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) | |
| Datasheet | Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) | |
| Datasheet | Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) |
| Citations for Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) – 1 Found |
| Grou, Cláudia P; Pinto, Manuel P; Mendes, Andreia V; Domingues, Pedro; Azevedo, Jorge E. The de novo synthesis of ubiquitin: identification of deubiquitinases acting on ubiquitin precursors. Scientific Reports. 2015;5( 26235645):12836. PubMed |