Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA051074-25

Protein Description: OTU deubiquitinase with linear linkage specificity
Gene Name: OTULIN
Alternative Gene Name: FAM105B, FLJ34884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046034: 93%, ENSRNOG00000012017: 89%
Entrez Gene ID: 90268
Uniprot ID: Q96BN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP
• Gene Sequence: DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP
• Gene ID - Mouse: ENSMUSG00000046034
• Gene ID - Rat: ENSRNOG00000012017
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) – 1 Found

Grou, Cláudia P; Pinto, Manuel P; Mendes, Andreia V; Domingues, Pedro; Azevedo, Jorge E. The de novo synthesis of ubiquitin: identification of deubiquitinases acting on ubiquitin precursors. Scientific Reports. 2015;5( 26235645):12836.