Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051074-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: OTULIN
Alternative Gene Name: FAM105B, FLJ34884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046034: 93%, ENSRNOG00000012017: 89%
Entrez Gene ID: 90268
Uniprot ID: Q96BN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP |
Gene Sequence | DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP |
Gene ID - Mouse | ENSMUSG00000046034 |
Gene ID - Rat | ENSRNOG00000012017 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) | |
Datasheet | Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) | |
Datasheet | Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) |
Citations for Anti OTULIN pAb (ATL-HPA051074 w/enhanced validation) – 1 Found |
Grou, Cláudia P; Pinto, Manuel P; Mendes, Andreia V; Domingues, Pedro; Azevedo, Jorge E. The de novo synthesis of ubiquitin: identification of deubiquitinases acting on ubiquitin precursors. Scientific Reports. 2015;5( 26235645):12836. PubMed |