Anti OSER1 pAb (ATL-HPA045125 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045125-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: OSER1
Alternative Gene Name: C20orf111, dJ1183I21.1, HSPC207, Osr1, Perit1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035399: 92%, ENSRNOG00000008297: 91%
Entrez Gene ID: 51526
Uniprot ID: Q9NX31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKPCTCIGKECQCKRWHDMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIPKKMS |
| Gene Sequence | GKPCTCIGKECQCKRWHDMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIPKKMS |
| Gene ID - Mouse | ENSMUSG00000035399 |
| Gene ID - Rat | ENSRNOG00000008297 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OSER1 pAb (ATL-HPA045125 w/enhanced validation) | |
| Datasheet | Anti OSER1 pAb (ATL-HPA045125 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OSER1 pAb (ATL-HPA045125 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti OSER1 pAb (ATL-HPA045125 w/enhanced validation) | |
| Datasheet | Anti OSER1 pAb (ATL-HPA045125 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OSER1 pAb (ATL-HPA045125 w/enhanced validation) |