Anti OSER1 pAb (ATL-HPA045125 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045125-25

Protein Description: oxidative stress responsive serine-rich 1
Gene Name: OSER1
Alternative Gene Name: C20orf111, dJ1183I21.1, HSPC207, Osr1, Perit1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035399: 92%, ENSRNOG00000008297: 91%
Entrez Gene ID: 51526
Uniprot ID: Q9NX31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKPCTCIGKECQCKRWHDMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIPKKMS
• Gene Sequence: GKPCTCIGKECQCKRWHDMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIPKKMS
• Gene ID - Mouse: ENSMUSG00000035399
• Gene ID - Rat: ENSRNOG00000008297
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.