Anti OSBP pAb (ATL-HPA039227 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039227-25

Protein Description: oxysterol binding protein
Gene Name: OSBP
Alternative Gene Name: OSBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024687: 96%, ENSRNOG00000021057: 97%
Entrez Gene ID: 5007
Uniprot ID: P22059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLERAFRGATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKP
• Gene Sequence: HLERAFRGATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKP
• Gene ID - Mouse: ENSMUSG00000024687
• Gene ID - Rat: ENSRNOG00000021057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OSBP pAb (ATL-HPA039227 w/enhanced validation) – 2 Found

Hussain, Syed Saad; Harris, Megan T; Kreutzberger, Alex J B; Inouye, Candice M; Doyle, Catherine A; Castle, Anna M; Arvan, Peter; Castle, J David. Control of insulin granule formation and function by the ABC transporters ABCG1 and ABCA1 and by oxysterol binding protein OSBP. Molecular Biology Of The Cell. 2018;29(10):1238-1257. 

Kutchukian, Candice; Vivas, Oscar; Casas, Maria; Jones, Julia G; Tiscione, Scott A; Simó, Sergi; Ory, Daniel S; Dixon, Rose E; Dickson, Eamonn J. NPC1 regulates the distribution of phosphatidylinositol 4-kinases at Golgi and lysosomal membranes. The Embo Journal. 2021;40(13):e105990.