Anti OR8S1 pAb (ATL-HPA045595)

Atlas Antibodies

Catalog No.: ATL-HPA045595-25

Protein Description: olfactory receptor, family 8, subfamily S, member 1
Gene Name: OR8S1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031790: 36%, ENSRNOG00000051980: 36%
Entrez Gene ID: 341568
Uniprot ID: Q8NH09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQP
• Gene Sequence: ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQP
• Gene ID - Mouse: ENSMUSG00000031790
• Gene ID - Rat: ENSRNOG00000051980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.