Anti OR5T3 pAb (ATL-HPA044986)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044986-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: OR5T3
Alternative Gene Name: OR5T3Q
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047969: 33%, ENSRNOG00000010474: 35%
Entrez Gene ID: 390154
Uniprot ID: Q8NGG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMF |
| Gene Sequence | STFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMF |
| Gene ID - Mouse | ENSMUSG00000047969 |
| Gene ID - Rat | ENSRNOG00000010474 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OR5T3 pAb (ATL-HPA044986) | |
| Datasheet | Anti OR5T3 pAb (ATL-HPA044986) Datasheet (External Link) |
| Vendor Page | Anti OR5T3 pAb (ATL-HPA044986) at Atlas Antibodies |
| Documents & Links for Anti OR5T3 pAb (ATL-HPA044986) | |
| Datasheet | Anti OR5T3 pAb (ATL-HPA044986) Datasheet (External Link) |
| Vendor Page | Anti OR5T3 pAb (ATL-HPA044986) |