Anti OR5T3 pAb (ATL-HPA044986)

Atlas Antibodies

Catalog No.:
ATL-HPA044986-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: olfactory receptor, family 5, subfamily T, member 3
Gene Name: OR5T3
Alternative Gene Name: OR5T3Q
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047969: 33%, ENSRNOG00000010474: 35%
Entrez Gene ID: 390154
Uniprot ID: Q8NGG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMF
Gene Sequence STFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMF
Gene ID - Mouse ENSMUSG00000047969
Gene ID - Rat ENSRNOG00000010474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OR5T3 pAb (ATL-HPA044986)
Datasheet Anti OR5T3 pAb (ATL-HPA044986) Datasheet (External Link)
Vendor Page Anti OR5T3 pAb (ATL-HPA044986) at Atlas Antibodies

Documents & Links for Anti OR5T3 pAb (ATL-HPA044986)
Datasheet Anti OR5T3 pAb (ATL-HPA044986) Datasheet (External Link)
Vendor Page Anti OR5T3 pAb (ATL-HPA044986)