Anti OR51J1 pAb (ATL-HPA017605)

Atlas Antibodies

Catalog No.: ATL-HPA017605-25

Protein Description: olfactory receptor, family 51, subfamily J, member 1 (gene/pseudogene)
Gene Name: OR51J1
Alternative Gene Name: OR51J1P, OR51J2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050015: 26%, ENSRNOG00000024877: 26%
Entrez Gene ID: 79470
Uniprot ID: Q9H342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNTEISLEACLFPDVLHPFFIHDGASCAAGHVFGPLYSHLQPTELHSYPDTAQGLWHRSYYRTEKHYAHGS
• Gene Sequence: GNTEISLEACLFPDVLHPFFIHDGASCAAGHVFGPLYSHLQPTELHSYPDTAQGLWHRSYYRTEKHYAHGS
• Gene ID - Mouse: ENSMUSG00000050015
• Gene ID - Rat: ENSRNOG00000024877
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OR51J1 pAb (ATL-HPA017605) – 1 Found

Asadi, Maryam; Ahmadi, Nahid; Ahmadvand, Simin; Jafari, Ali Akbar; Safaei, Akbar; Erfani, Nasrollah; Ramezani, Amin. Investigation of olfactory receptor family 51 subfamily j member 1 (OR51J1) gene susceptibility as a potential breast cancer-associated biomarker. Plos One. 16(2):e0246752.