Anti OR11H1 pAb (ATL-HPA047370)

Atlas Antibodies

Catalog No.:
ATL-HPA047370-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: olfactory receptor, family 11, subfamily H, member 1
Gene Name: OR11H1
Alternative Gene Name: OR22-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033790: 32%, ENSRNOG00000014166: 38%
Entrez Gene ID: 81061
Uniprot ID: Q8NG94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCPLTLQVTGLMNVSEPNSSFAFVNEFILQG
Gene Sequence MCPLTLQVTGLMNVSEPNSSFAFVNEFILQG
Gene ID - Mouse ENSMUSG00000033790
Gene ID - Rat ENSRNOG00000014166
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OR11H1 pAb (ATL-HPA047370)
Datasheet Anti OR11H1 pAb (ATL-HPA047370) Datasheet (External Link)
Vendor Page Anti OR11H1 pAb (ATL-HPA047370) at Atlas Antibodies

Documents & Links for Anti OR11H1 pAb (ATL-HPA047370)
Datasheet Anti OR11H1 pAb (ATL-HPA047370) Datasheet (External Link)
Vendor Page Anti OR11H1 pAb (ATL-HPA047370)