Anti OR11H1 pAb (ATL-HPA047370)

Atlas Antibodies

Catalog No.: ATL-HPA047370-25

Protein Description: olfactory receptor, family 11, subfamily H, member 1
Gene Name: OR11H1
Alternative Gene Name: OR22-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033790: 32%, ENSRNOG00000014166: 38%
Entrez Gene ID: 81061
Uniprot ID: Q8NG94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MCPLTLQVTGLMNVSEPNSSFAFVNEFILQG
• Gene Sequence: MCPLTLQVTGLMNVSEPNSSFAFVNEFILQG
• Gene ID - Mouse: ENSMUSG00000033790
• Gene ID - Rat: ENSRNOG00000014166
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.