Anti OR11H1 pAb (ATL-HPA047370)
Atlas Antibodies
- SKU:
- ATL-HPA047370-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: OR11H1
Alternative Gene Name: OR22-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033790: 32%, ENSRNOG00000014166: 38%
Entrez Gene ID: 81061
Uniprot ID: Q8NG94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MCPLTLQVTGLMNVSEPNSSFAFVNEFILQG |
Gene Sequence | MCPLTLQVTGLMNVSEPNSSFAFVNEFILQG |
Gene ID - Mouse | ENSMUSG00000033790 |
Gene ID - Rat | ENSRNOG00000014166 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OR11H1 pAb (ATL-HPA047370) | |
Datasheet | Anti OR11H1 pAb (ATL-HPA047370) Datasheet (External Link) |
Vendor Page | Anti OR11H1 pAb (ATL-HPA047370) at Atlas Antibodies |
Documents & Links for Anti OR11H1 pAb (ATL-HPA047370) | |
Datasheet | Anti OR11H1 pAb (ATL-HPA047370) Datasheet (External Link) |
Vendor Page | Anti OR11H1 pAb (ATL-HPA047370) |