Anti OPTN pAb (ATL-HPA003279 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003279-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: OPTN
Alternative Gene Name: FIP-2, FIP2, GLC1E, HIP7, HYPL, NRP, TFIIIA-INTP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026672: 85%, ENSRNOG00000017941: 88%
Entrez Gene ID: 10133
Uniprot ID: Q96CV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVL |
| Gene Sequence | LELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVL |
| Gene ID - Mouse | ENSMUSG00000026672 |
| Gene ID - Rat | ENSRNOG00000017941 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OPTN pAb (ATL-HPA003279 w/enhanced validation) | |
| Datasheet | Anti OPTN pAb (ATL-HPA003279 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OPTN pAb (ATL-HPA003279 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti OPTN pAb (ATL-HPA003279 w/enhanced validation) | |
| Datasheet | Anti OPTN pAb (ATL-HPA003279 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OPTN pAb (ATL-HPA003279 w/enhanced validation) |
| Citations for Anti OPTN pAb (ATL-HPA003279 w/enhanced validation) – 3 Found |
| Fracchiolla, Dorotea; Sawa-Makarska, Justyna; Zens, Bettina; Ruiter, Anita de; Zaffagnini, Gabriele; Brezovich, Andrea; Romanov, Julia; Runggatscher, Kathrin; Kraft, Claudine; Zagrovic, Bojan; Martens, Sascha. Mechanism of cargo-directed Atg8 conjugation during selective autophagy. Elife. 2016;5( 27879200) PubMed |
| van Well, Eva M; Bader, Verian; Patra, Maria; Sánchez-Vicente, Ana; Meschede, Jens; Furthmann, Nikolas; Schnack, Cathrin; Blusch, Alina; Longworth, Joseph; Petrasch-Parwez, Elisabeth; Mori, Kohji; Arzberger, Thomas; Trümbach, Dietrich; Angersbach, Lena; Showkat, Cathrin; Sehr, Dominik A; Berlemann, Lena A; Goldmann, Petra; Clement, Albrecht M; Behl, Christian; Woerner, Andreas C; Saft, Carsten; Wurst, Wolfgang; Haass, Christian; Ellrichmann, Gisa; Gold, Ralf; Dittmar, Gunnar; Hipp, Mark S; Hartl, F Ulrich; Tatzelt, Jörg; Winklhofer, Konstanze F. A protein quality control pathway regulated by linear ubiquitination. The Embo Journal. 2019;38(9) PubMed |
| Wu, Zhixiao; Berlemann, Lena A; Bader, Verian; Sehr, Dominik A; Dawin, Eva; Covallero, Alberto; Meschede, Jens; Angersbach, Lena; Showkat, Cathrin; Michaelis, Jonas B; Münch, Christian; Rieger, Bettina; Namgaladze, Dmitry; Herrera, Maria Georgina; Fiesel, Fabienne C; Springer, Wolfdieter; Mendes, Marta; Stepien, Jennifer; Barkovits, Katalin; Marcus, Katrin; Sickmann, Albert; Dittmar, Gunnar; Busch, Karin B; Riedel, Dietmar; Brini, Marisa; Tatzelt, Jörg; Cali, Tito; Winklhofer, Konstanze F. LUBAC assembles a ubiquitin signaling platform at mitochondria for signal amplification and transport of NF-κB to the nucleus. The Embo Journal. 2022;41(24):e112006. PubMed |