Anti OPLAH pAb (ATL-HPA028260)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028260-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: OPLAH
Alternative Gene Name: 5-Opase, OPLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022562: 93%, ENSRNOG00000011781: 95%
Entrez Gene ID: 26873
Uniprot ID: O14841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDPVHIHRHSGLLSALGLALADVVHEAQEPCSLLYAPETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQH |
| Gene Sequence | MDPVHIHRHSGLLSALGLALADVVHEAQEPCSLLYAPETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQH |
| Gene ID - Mouse | ENSMUSG00000022562 |
| Gene ID - Rat | ENSRNOG00000011781 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OPLAH pAb (ATL-HPA028260) | |
| Datasheet | Anti OPLAH pAb (ATL-HPA028260) Datasheet (External Link) |
| Vendor Page | Anti OPLAH pAb (ATL-HPA028260) at Atlas Antibodies |
| Documents & Links for Anti OPLAH pAb (ATL-HPA028260) | |
| Datasheet | Anti OPLAH pAb (ATL-HPA028260) Datasheet (External Link) |
| Vendor Page | Anti OPLAH pAb (ATL-HPA028260) |