Anti OPLAH pAb (ATL-HPA028260)

Atlas Antibodies

Catalog No.:
ATL-HPA028260-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: 5-oxoprolinase (ATP-hydrolysing)
Gene Name: OPLAH
Alternative Gene Name: 5-Opase, OPLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022562: 93%, ENSRNOG00000011781: 95%
Entrez Gene ID: 26873
Uniprot ID: O14841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDPVHIHRHSGLLSALGLALADVVHEAQEPCSLLYAPETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQH
Gene Sequence MDPVHIHRHSGLLSALGLALADVVHEAQEPCSLLYAPETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMVSAHQH
Gene ID - Mouse ENSMUSG00000022562
Gene ID - Rat ENSRNOG00000011781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OPLAH pAb (ATL-HPA028260)
Datasheet Anti OPLAH pAb (ATL-HPA028260) Datasheet (External Link)
Vendor Page Anti OPLAH pAb (ATL-HPA028260) at Atlas Antibodies

Documents & Links for Anti OPLAH pAb (ATL-HPA028260)
Datasheet Anti OPLAH pAb (ATL-HPA028260) Datasheet (External Link)
Vendor Page Anti OPLAH pAb (ATL-HPA028260)